Recombinant Mouse Il13 Protein

Cat.No. : Il13-088M
Product Overview : Purified recombinant protein of Mouse interleukin 13 (Il13) without tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Cytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses. Positively regulates IL31RA expression in macrophages.
Molecular Mass : 12.2 kDa
AA Sequence : MPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF
Endotoxin : Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity : >95%, as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.2
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name Il13 interleukin 13 [ Mus musculus (house mouse) ]
Official Symbol Il13
Synonyms Il13; interleukin 13; Il-13; interleukin-13; T-cell activation protein P600
Gene ID 16163
mRNA Refseq NM_008355
Protein Refseq NP_032381
UniProt ID P20109

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il13 Products

Required fields are marked with *

My Review for All Il13 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon