Recombinant Mouse Lgmn Protein, His-tagged
Cat.No. : | Lgmn-7311M |
Product Overview : | Recombinant Mouse Lgmn protein with a His tag was expressed in insect cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 18-435 |
Description : | This gene encodes a member of the cysteine peptidase family C13 that plays an important role in the endosome/lysosomal degradation system. The encoded inactive preproprotein undergoes autocatalytic removal of the C-terminal inhibitory propeptide to generate the active endopeptidase that cleaves protein substrates on the C-terminal side of asparagine residues. Mice lacking the encoded protein exhibit defects in the lysosomal processing of proteins resulting in their accumulation in the lysosomes, and develop symptoms resembling hemophagocytic lymphohistiocytosis. |
Form : | Liquid |
Molecular Mass : | 48.6 kDa |
AA Sequence : | VPVGVDDPEDGGKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIIVMMYDDIANSEENPTPGVVINRPNGTDVYKGVLKDYTGEDVTPENFLAVLRGDAEAVKGKGSGKVLKSGPRDHVFIYFTDHGATGILVFPNDDLHVKDLNKTIRYMYEHKMYQKMVFYIEACESGSMMNHLPDDINVYATTAANPKESSYACYYDEERGTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKSISTMKVMQFQGMKHRASSPISLPPVTHLDLTPSPDVPLTILKRKLLRTNDVKESQNLIGQIQQFLDARHVIEKSVHKIVSLLAGFGETAERHLSERTMLTAHDCYQEAVTHFRTHCFNWHSVTYEHALRYLYVLANLCEAPYPIDRIEMAMDKVCLSHYLEHHHHHH |
Endotoxin : | < 1.0 EU/μg of protein (determined by LAL method) |
Purity : | > 90 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 0.5 mg/mL (determined by absorbance at 280nm) |
Storage Buffer : | Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol. |
Gene Name | Lgmn legumain [ Mus musculus (house mouse) ] |
Official Symbol | Lgmn |
Synonyms | Lgmn; legumain; A; Pr; AEP; Prsc1; AI746452; AU022324; legumain; asparaginyl endopeptidase; preprolegumain; protease, cysteine, 1; EC 3.4.22.34 |
Gene ID | 19141 |
mRNA Refseq | NM_011175 |
Protein Refseq | NP_035305 |
UniProt ID | O89017 |
◆ Recombinant Proteins | ||
LGMN-3171H | Recombinant Human LGMN protein, His-tagged | +Inquiry |
LGMN-674H | Recombinant Human LGMN protein, His-tagged | +Inquiry |
LGMN-2160M | Recombinant Mouse LGMN Protein (18-325 aa), His-tagged | +Inquiry |
LGMN-526H | Recombinant Human LGMN Protein, MYC/DDK-tagged | +Inquiry |
LGMN-2238C | Recombinant Cynomolgus monkey LGMN protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LGMN-001SCL | Recombinant Sus scrofa (Pig) LGMN cell lysate | +Inquiry |
LGMN-2893MCL | Recombinant Mouse LGMN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Lgmn Products
Required fields are marked with *
My Review for All Lgmn Products
Required fields are marked with *
0
Inquiry Basket