Recombinant Human LGMN protein, T7/His-tagged
| Cat.No. : | LGMN-216H |
| Product Overview : | Recombinant human LGMN (416aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Form : | 0.4 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, Sucrose and DTT. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFVPIDDPEDGGKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPD EQIVVMMYDDIAYSEDNPTPGIVINRPNGTDVYQGVPKDYTGEDVTPQNFLAVLRGDAEAVKGIGSGKVLKSGPQ DHVFIYFTDHGSTGILVFPNEDLHVKDLNETIHYMYKHKMYRKMVFYIEACESGSMMNHLPDNINVYATTAANPR ESSYACYYDEKRSTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKTISTMKVMQFQGMKR KASSPVPLPPVTHLDLTPSPDVPLTIMKRKLMNTNDLEESRQLTEEIQRHLDARHLIEKSVRKIVSLLAASEAEV EQLLSERAPLTGHSCYPEALLHFRTHCFNWHSPTYEYALRHLYVLVNLCEKPYPLHRIKLSMDHVCLGHY |
| Purity : | >90% by SDS-PAGE |
| Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
| Gene Name | LGMN legumain [ Homo sapiens ] |
| Official Symbol | LGMN |
| Synonyms | LGMN; legumain; protease, cysteine, 1 (legumain) , PRSC1; LGMN1; cysteine protease 1; protease, cysteine 1; asparaginyl endopeptidase; protease, cysteine, 1 (legumain); AEP; PRSC1; |
| Gene ID | 5641 |
| mRNA Refseq | NM_001008530 |
| Protein Refseq | NP_001008530 |
| MIM | 602620 |
| UniProt ID | Q99538 |
| Chromosome Location | 14q32.12 |
| Pathway | Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; Metabolism, organism-specific biosystem; |
| Function | cysteine-type endopeptidase activity; cysteine-type endopeptidase activity; peptidase activity; |
| ◆ Recombinant Proteins | ||
| LGMN-3394R | Recombinant Rat LGMN Protein | +Inquiry |
| Lgmn-3778M | Recombinant Mouse Lgmn Protein, Myc/DDK-tagged | +Inquiry |
| Lgmn-1059M | Active Recombinant Mouse Lgmn Protein, His-tagged | +Inquiry |
| LGMN-570P | Recombinant Pig LGMN, His-tagged | +Inquiry |
| LGMN-2549C | Recombinant Cynomolgus Monkey LGMN Protein (18-323 aa), His-Myc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LGMN-001SCL | Recombinant Sus scrofa (Pig) LGMN cell lysate | +Inquiry |
| LGMN-2893MCL | Recombinant Mouse LGMN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LGMN Products
Required fields are marked with *
My Review for All LGMN Products
Required fields are marked with *
