Recombinant Mouse MGLL Protein (1-303 aa), His-SUMO-tagged
Cat.No. : | MGLL-2215M |
Product Overview : | Recombinant Mouse MGLL Protein (1-303 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-303 aa |
Description : | Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain. Regulates the levels of fatty acids that serve as signaling molecules and promote cancer cell migration, invasion and tumor growth. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 49.4 kDa |
AA Sequence : | MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYWKPSGTPKALIFVSHGAGEHCGRYDELAHMLKGLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDVLQHVDTIQKDYPDVPIFLLGHSMGGAISILVAAERPTYFSGMVLISPLVLANPESASTLKVLAAKLLNFVLPNMTLGRIDSSVLSRNKSEVDLYNSDPLVCRAGLKVCFGIQLLNAVARVERAMPRLTLPFLLLQGSADRLCDSKGAYLLMESSRSQDKTLKMYEGAYHVLHRELPEVTNSVLHEVNSWVSHRIAAAGAGCPP |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Mgll monoglyceride lipase [ Mus musculus ] |
Official Symbol | MGLL |
Synonyms | MGLL; monoglyceride lipase; monoacylglycerol lipase; Mgl; Magl; AA589436; |
Gene ID | 23945 |
mRNA Refseq | NM_001166249 |
Protein Refseq | NP_001159721 |
UniProt ID | O35678 |
◆ Recombinant Proteins | ||
MGLL-0324H | Recombinant Human MGLL Protein (P2-P303), His tagged | +Inquiry |
MGLL-10628Z | Recombinant Zebrafish MGLL | +Inquiry |
MGLL-3983H | Recombinant Human MGLL Protein (Met1-Pro303), N-His tagged | +Inquiry |
MGLL-1407H | Recombinant Human MGLL Protein, His (Fc)-Avi-tagged | +Inquiry |
MGLL18930H | Recombinant Human MGLL (1-303) (K36A L169S L176S) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MGLL-4331HCL | Recombinant Human MGLL 293 Cell Lysate | +Inquiry |
MGLL-4330HCL | Recombinant Human MGLL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MGLL Products
Required fields are marked with *
My Review for All MGLL Products
Required fields are marked with *
0
Inquiry Basket