Recombinant Human MGLL Protein, GST-tagged
Cat.No. : | MGLL-5303H |
Product Overview : | Human MGLL full-length ORF ( NP_009214.1, 1 a.a. - 313 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Monoglyceride lipase (MGLL; EC 3.1.1.23) functions together with hormone-sensitive lipase (LIPE; MIM 151750) to hydrolyze intracellular triglyceride stores in adipocytes and other cells to fatty acids and glycerol. MGLL may also complement lipoprotein lipase (LPL; MIM 238600) in completing hydrolysis of monoglycerides resulting from degradation of lipoprotein triglycerides (Karlsson et al., 2001 [PubMed 11470505]).[supplied by OMIM |
Molecular Mass : | 60.7 kDa |
AA Sequence : | METGPEDPSSMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MGLL monoglyceride lipase [ Homo sapiens ] |
Official Symbol | MGLL |
Synonyms | MGLL; monoglyceride lipase; HU K5; MGL; monoacylglycerol lipase; lysophospholipase homolog; HUK5; MAGL; HU-K5; |
Gene ID | 11343 |
mRNA Refseq | NM_001003794 |
Protein Refseq | NP_001003794 |
MIM | 609699 |
UniProt ID | Q99685 |
◆ Recombinant Proteins | ||
MGLL-6353H | Recombinant Human MGLL protein, His-tagged | +Inquiry |
Mgll-206R | Recombinant Rat Mgll, His-tagged | +Inquiry |
MGLL-9816M | Recombinant Mouse MGLL Protein | +Inquiry |
MGLL-103H | Recombinant Human MGLL Protein, His-tagged | +Inquiry |
MGLL-0323H | Recombinant Human MGLL Protein (P2-P303), Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
MGLL-4331HCL | Recombinant Human MGLL 293 Cell Lysate | +Inquiry |
MGLL-4330HCL | Recombinant Human MGLL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MGLL Products
Required fields are marked with *
My Review for All MGLL Products
Required fields are marked with *