Recombinant Human MGLL protein, His-tagged
Cat.No. : | MGLL-6353H |
Product Overview : | Recombinant Human MGLL protein(1-313 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-313 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | METGPEDPSSMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | MGLL monoglyceride lipase [ Homo sapiens ] |
Official Symbol | MGLL |
Synonyms | MGLL; monoglyceride lipase; HU K5; MGL; monoacylglycerol lipase; lysophospholipase homolog; HUK5; MAGL; HU-K5; |
Gene ID | 11343 |
mRNA Refseq | NM_001003794 |
Protein Refseq | NP_001003794 |
MIM | 609699 |
UniProt ID | Q99685 |
◆ Recombinant Proteins | ||
MGLL-3221H | Recombinant Human MGLL protein, GST-tagged | +Inquiry |
MGLL-2006H | Recombinant Human MGLL Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MGLL-730HFL | Recombinant Full Length Human MGLL Protein, C-Flag-tagged | +Inquiry |
MGLL-0323H | Recombinant Human MGLL Protein (P2-P303), Tag Free | +Inquiry |
MGLL-1407H | Recombinant Human MGLL Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MGLL-4330HCL | Recombinant Human MGLL 293 Cell Lysate | +Inquiry |
MGLL-4331HCL | Recombinant Human MGLL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MGLL Products
Required fields are marked with *
My Review for All MGLL Products
Required fields are marked with *