Recombinant Mouse Mif Protein, His-tagged
Cat.No. : | Mif-7286M |
Product Overview : | Recombinant Mouse Mif protein with a His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-115 |
Description : | Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity. |
Form : | Liquid |
Molecular Mass : | 14.9 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSMPMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA |
Purity : | > 90 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 0.5 mg/mL (determined by bradford assay) |
Storage Buffer : | Phosphate buffered saline containing 10 % glycerol, 1 mM DTT. |
Gene Name | Mif macrophage migration inhibitory factor (glycosylation-inhibiting factor) [ Mus musculus (house mouse) ] |
Official Symbol | Mif |
Synonyms | Mif; macrophage migration inhibitory factor (glycosylation-inhibiting factor); Gl; GIF; DER6; Glif; macrophage migration inhibitory factor; L-dopachrome isomerase; L-dopachrome tautomerase; delayed early response protein 6; phenylpyruvate tautomerase; EC 5.3.2.1; EC 5.3.3.12 |
Gene ID | 17319 |
mRNA Refseq | NM_010798 |
Protein Refseq | NP_034928 |
UniProt ID | P34884 |
◆ Recombinant Proteins | ||
Mif-5465M | Recombinant Mouse Mif protein, His-tagged | +Inquiry |
MIF-81H | Recombinant Human MIF, His-tagged | +Inquiry |
MIF-23H | Recombinant Human MIF protein, His-tagged | +Inquiry |
Mif-676R | Recombinant Rat Mif protein, His-tagged | +Inquiry |
MIF-1047H | Recombinant Human MIF protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MIF-1884MCL | Recombinant Mouse MIF cell lysate | +Inquiry |
MIF-1917HCL | Recombinant Human MIF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Mif Products
Required fields are marked with *
My Review for All Mif Products
Required fields are marked with *
0
Inquiry Basket