Active Recombinant Human MIF Protein, His-tagged

Cat.No. : MIF-736H
Product Overview : Recombinant Human MIF fused with His tag at N-terminal was expressed in Hi-5 Insect cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Hi-5 Insect Cells
Tag : His
Description : This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways.
Form : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2
Bio-activity : Determined by its ability to inhibit monocyte migration.
Molecular Mass : 15 kDa
AA Sequence : HHHHHHHHAMPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Resuspend the protein in the desired concentration in proper buffer
Gene Name MIF macrophage migration inhibitory factor (glycosylation-inhibiting factor) [ Homo sapiens ]
Official Symbol MIF
Synonyms MIF; macrophage migration inhibitory factor (glycosylation-inhibiting factor); GLIF; macrophage migration inhibitory factor; GIF; L-dopachrome isomerase; L-dopachrome tautomerase; phenylpyruvate tautomerase; MMIF;
Gene ID 4282
mRNA Refseq NM_002415
Protein Refseq NP_002406
MIM 153620
UniProt ID P14174

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MIF Products

Required fields are marked with *

My Review for All MIF Products

Required fields are marked with *

0
cart-icon
0
compare icon