Active Recombinant Human MIF Protein, His-tagged
Cat.No. : | MIF-736H |
Product Overview : | Recombinant Human MIF fused with His tag at N-terminal was expressed in Hi-5 Insect cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Hi-5 Insect Cells |
Tag : | His |
Description : | This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2 |
Bio-activity : | Determined by its ability to inhibit monocyte migration. |
Molecular Mass : | 15 kDa |
AA Sequence : | HHHHHHHHAMPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Resuspend the protein in the desired concentration in proper buffer |
Gene Name | MIF macrophage migration inhibitory factor (glycosylation-inhibiting factor) [ Homo sapiens ] |
Official Symbol | MIF |
Synonyms | MIF; macrophage migration inhibitory factor (glycosylation-inhibiting factor); GLIF; macrophage migration inhibitory factor; GIF; L-dopachrome isomerase; L-dopachrome tautomerase; phenylpyruvate tautomerase; MMIF; |
Gene ID | 4282 |
mRNA Refseq | NM_002415 |
Protein Refseq | NP_002406 |
MIM | 153620 |
UniProt ID | P14174 |
◆ Recombinant Proteins | ||
Mif-331M | Recombinant Mouse Mif Protein (115 aa) | +Inquiry |
MIF-5464H | Recombinant Human MIF protein, His-tagged | +Inquiry |
Mif-488R | Recombinant Rat Mif protein | +Inquiry |
MIF-3683R | Recombinant Rat MIF Protein | +Inquiry |
Mif-675M | Recombinant Mouse Mif protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MIF-1884MCL | Recombinant Mouse MIF cell lysate | +Inquiry |
MIF-1917HCL | Recombinant Human MIF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MIF Products
Required fields are marked with *
My Review for All MIF Products
Required fields are marked with *