Recombinant Mouse Myl9 Protein, His-tagged

Cat.No. : Myl9-7422M
Product Overview : Recombinant mouse Myl9 with a His tag was expressed in E. coli and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 1-172
Description : Myosin regulatory subunit that plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation. Implicated in cytokinesis, receptor capping, and cell locomotion.
Form : Liquid
Molecular Mass : 22.4 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGSHMSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLEGMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD
Purity : > 90 % by SDS-PAGE
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
Concentration : 0.5 mg/mL (determined by bradford assay)
Storage Buffer : Phosphate buffered saline (pH 7.4) containing 10 % glycerol, 1 mM DTT.
Gene Name Myl9 myosin, light polypeptide 9, regulatory [ Mus musculus (house mouse) ]
Official Symbol Myl9
Synonyms Myl9; myosin, light polypeptide 9, regulatory; RLC; MLC2; MLC20; Mylc2; RLC-C; Mylc2c; AI327049; myosin regulatory light polypeptide 9; myosin light chain, regulatory C; myosin regulatory light chain 9
Gene ID 98932
mRNA Refseq NM_172118
Protein Refseq NP_742116
UniProt ID Q9CQ19

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Myl9 Products

Required fields are marked with *

My Review for All Myl9 Products

Required fields are marked with *

0
cart-icon