Recombinant Mouse Myl9 Protein, His-tagged
Cat.No. : | Myl9-7422M |
Product Overview : | Recombinant mouse Myl9 with a His tag was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-172 |
Description : | Myosin regulatory subunit that plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation. Implicated in cytokinesis, receptor capping, and cell locomotion. |
Form : | Liquid |
Molecular Mass : | 22.4 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSHMSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLEGMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD |
Purity : | > 90 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 0.5 mg/mL (determined by bradford assay) |
Storage Buffer : | Phosphate buffered saline (pH 7.4) containing 10 % glycerol, 1 mM DTT. |
Gene Name | Myl9 myosin, light polypeptide 9, regulatory [ Mus musculus (house mouse) ] |
Official Symbol | Myl9 |
Synonyms | Myl9; myosin, light polypeptide 9, regulatory; RLC; MLC2; MLC20; Mylc2; RLC-C; Mylc2c; AI327049; myosin regulatory light polypeptide 9; myosin light chain, regulatory C; myosin regulatory light chain 9 |
Gene ID | 98932 |
mRNA Refseq | NM_172118 |
Protein Refseq | NP_742116 |
UniProt ID | Q9CQ19 |
◆ Recombinant Proteins | ||
Myl9-57M | Recombinant Mouse Myl9, His-tagged | +Inquiry |
MYL9-3857R | Recombinant Rat MYL9 Protein | +Inquiry |
Myl9-4256M | Recombinant Mouse Myl9 Protein, Myc/DDK-tagged | +Inquiry |
MYL9-6765HF | Recombinant Full Length Human MYL9 Protein, GST-tagged | +Inquiry |
MYL9-3744H | Recombinant Human MYL9 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYL9-4020HCL | Recombinant Human MYL9 293 Cell Lysate | +Inquiry |
MYL9-4019HCL | Recombinant Human MYL9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Myl9 Products
Required fields are marked with *
My Review for All Myl9 Products
Required fields are marked with *
0
Inquiry Basket