Recombinant Human MYL9 protein, His-tagged
Cat.No. : | MYL9-3744H |
Product Overview : | Recombinant Human MYL9 protein(1-118 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-118 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD |
Gene Name | MYL9 myosin, light chain 9, regulatory [ Homo sapiens ] |
Official Symbol | MYL9 |
Synonyms | MYL9; myosin, light chain 9, regulatory; myosin, light polypeptide 9, regulatory; myosin regulatory light polypeptide 9; LC20; MLC2; MRLC1; myosin regulatory light chain 1; myosin regulatory light chain 2; smooth muscle isoform; MYRL2; myosin RLC; 20 kDa myosin light chain; myosin regulatory light chain 9; myosin regulatory light chain MRLC1; myosin regulatory light chain 2, smooth muscle isoform; MLC-2C; MGC3505; |
Gene ID | 10398 |
mRNA Refseq | NM_006097 |
Protein Refseq | NP_006088 |
MIM | 609905 |
UniProt ID | P24844 |
◆ Recombinant Proteins | ||
Myl9-57M | Recombinant Mouse Myl9, His-tagged | +Inquiry |
MYL9-3447H | Recombinant Human MYL9 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MYL9-6765HF | Recombinant Full Length Human MYL9 Protein, GST-tagged | +Inquiry |
MYL9-3445H | Recombinant Human MYL9 protein, His-tagged | +Inquiry |
MYL9-3857R | Recombinant Rat MYL9 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYL9-4019HCL | Recombinant Human MYL9 293 Cell Lysate | +Inquiry |
MYL9-4020HCL | Recombinant Human MYL9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYL9 Products
Required fields are marked with *
My Review for All MYL9 Products
Required fields are marked with *