Recombinant Mouse S100a9 Protein, His-tagged
Cat.No. : | S100a9-7331M |
Product Overview : | Recombinant mouse S100A9 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-113 |
Description : | S100A9 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response. It can induce neutrophil chemotaxis, adhesion, can increase the bactericidal activity of neutrophils by promoting phagocytosis via activation of SYK, PI3K/AKT, and ERK1/2 and can induce degranulation of neutrophils by a MAPK-dependent mechanism. Predominantly found as calprotectin (S100A8/A9) which has a wide plethora of intra- and extracellular functions. The intracellular functions include: facilitating leukocyte arachidonic acid trafficking and metabolism, modulation of the tubulin-dependent cytoskeleton during migration of phagocytes and activation of the neutrophilic NADPH-oxidase. Activates NADPH-oxidase by facilitating the enzyme complex assembly at the cell membrane, transferring arachidonic acid, an essential cofactor, to the enzyme complex and S100A8 contributes to the enzyme assembly by directly binding to NCF2/P67PHOX. The extracellular functions involve proinflammatory, antimicrobial, oxidant-scavenging and apoptosis-inducing activities. Its proinflammatory activity includes recruitment of leukocytes, promotion of cytokine and chemokine production, and regulation of leukocyte adhesion and migration. Acts as an alarmin or a danger associated molecular pattern (DAMP) molecule and stimulates innate immune cells via binding to pattern recognition receptors such as Toll-like receptor 4 (TLR4) and receptor for advanced glycation endproducts (AGER). Binding to TLR4 and AGER activates the MAP-kinase and NF-kappa-B signaling pathways resulting in the amplification of the proinflammatory cascade. Has antimicrobial activity towards bacteria and fungi and exerts its antimicrobial activity probably via chelation of Zn2+ which is essential for microbial growth. Can induce cell death via autophagy and apoptosis and this occurs through the cross-talk of mitochondria and lysosomes via reactive oxygen species (ROS) and the process involves BNIP3. Can regulate neutrophil number and apoptosis by an anti-apoptotic effect; regulates cell survival via ITGAM/ITGB and TLR4 and a signaling mechanism involving MEK-ERK. Its role as an oxidant scavenger has a protective role in preventing exaggerated tissue damage by scavenging oxidants. The iNOS-S100A8/A9 transnitrosylase complex is proposed to direct selective inflammatory stimulus-dependent S-nitrosylation of multiple targets such as GAPDH, NXA5, EZR, MSN and VIM by recognizing a [IL]-x-C-x-x-[DE] motif. |
Form : | Liquid |
Molecular Mass : | 15.2 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK |
Purity : | > 90 % |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for up to two weeks or (in aliquots) at -20 or -70 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 0.5 mg/mL (determined by Bradford assay) |
Storage Buffer : | 20 mM Tris-HCl buffer (pH 8.0) containing 20 % glycerol, 1 mM DTT |
Gene Name | S100a9 S100 calcium binding protein A9 (calgranulin B) [ Mus musculus (house mouse) ] |
Official Symbol | S100a9 |
Synonyms | S100a9; S100 calcium binding protein A9 (calgranulin B); L1; p1; Cag; GAG; MRP; p14; Cagb; GAGB; L1Ag; 60B8A; BEE22; MRP14; 60B8Ag; AW546964; protein S100-A9; S100 calcium-binding protein A9; leukocyte L1 complex heavy chain; migration inhibitory factor-related protein 14 |
Gene ID | 20202 |
mRNA Refseq | NM_001281852 |
Protein Refseq | NP_001268781 |
UniProt ID | P31725 |
◆ Recombinant Proteins | ||
S100A9-0223D | Recombinant Full Length Dog S100A9 Protein, His-tagged | +Inquiry |
S100A9-3733H | Recombinant Full Length Human S100A9, His-tagged | +Inquiry |
S100a9-1806R | Recombinant Rat S100a9 protein, His-tagged | +Inquiry |
S100A9-2317B | Recombinant Bovine S100A9 Protein (2-156 aa), His-SUMO-Myc-tagged | +Inquiry |
S100A9-202H | Recombinant Human S100A9 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
S100A9-3179H | Native Human S100A9 protein(Met1-Pro114) | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100A9-684HCL | Recombinant Human S100A9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All S100a9 Products
Required fields are marked with *
My Review for All S100a9 Products
Required fields are marked with *
0
Inquiry Basket