Recombinant Mouse Sparc Protein, His-tagged
Cat.No. : | Sparc-034M |
Product Overview : | Recombinant mouse SPARC, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Insect cells |
Tag : | His |
Description : | Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca2+ with a low affinity and an EF-hand loop that binds a Ca2+ ion with a high affinity. |
Form : | Liquid |
Molecular Mass : | 33.3 kDa |
AA Sequence : | APQQTEVAEEIVEEETVVEETGVPVGANPVQVEMGEFEDGAEETVEEVVADNPCQNHHCKHGKVCELDESNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIAPCLDSELTEFPLRMRDWLKNVLVTLYERDEGNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALEEWAGCFGIKEQDINKDLVI |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 95% by SDS-PAGE |
Applications : | SDS-PAGE |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -113 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.25 mg/mL (determined by Absorbance at 280nm) |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
Gene Name | Sparc secreted acidic cysteine rich glycoprotein [ Mus musculus (house mouse) ] |
Official Symbol | Sparc |
Synonyms | Sparc; secreted acidic cysteine rich glycoprotein; ON; BM-40; osteo; SPARC; basement-membrane protein 40; osteonectin; secreted protein acidic and rich in cysteine |
Gene ID | 20692 |
mRNA Refseq | NM_009242 |
Protein Refseq | NP_033268 |
UniProt ID | P07214 |
◆ Recombinant Proteins | ||
SPARC-4111H | Recombinant Human SPARC Protein, His (Fc)-Avi-tagged | +Inquiry |
SPARC-263Z | Recombinant Zebrafish SPARC | +Inquiry |
SPARC-2899H | Recombinant Human SPARC, GST-tagged | +Inquiry |
SPARC-525H | Active Recombinant Human SPARC Protein, His-tagged | +Inquiry |
SPARC-102H | Recombinant Human SPARC protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
SPARC-287B | Native Bovine Osteonectin | +Inquiry |
SPARC-30653TH | Native Human SPARC | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPARC-2616HCL | Recombinant Human SPARC cell lysate | +Inquiry |
SPARC-2120MCL | Recombinant Mouse SPARC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Sparc Products
Required fields are marked with *
My Review for All Sparc Products
Required fields are marked with *