Recombinant Human SPARC protein, His-tagged

Cat.No. : SPARC-102H
Product Overview : Recombinant Human SPARC protein, fused to His-tag and was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 314
Description : This gene encodes a cysteine-rich acidic matrix-associated protein. The encoded protein is required for the collagen in bone to become calcified but is also involved in extracellular matrix synthesis and promotion of changes to cell shape. The gene product has been associated with tumor suppression but has also been correlated with metastasis based on changes to cell shape which can promote tumor cell invasion. Three transcript variants encoding different isoforms have been found for this gene.
Form : Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit the cell growth of Mv1Lu mink lung epithelial cells is less than 3.0 μg/mL, corresponding to a specific activity of > 333 IU/mg.
Molecular Mass : Approximately 36.1 kDa, a single non-glycosylated polypeptide chain containing 314 amino acids, with expression vector sequence (containing 6 x His tag).
AA Sequence : MSYYHHHHHHDYDIPTTENLYFQGAMGSAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI
Endotoxin : Less than 1 EU/μg of rHuSPARC, His as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analyses.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name SPARC
Official Symbol SPARC
Synonyms ON; OI17; BM-40
Gene ID 6678
mRNA Refseq NM_003118.4
Protein Refseq NP_003109.1
MIM 182120
UniProt ID P09486

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SPARC Products

Required fields are marked with *

My Review for All SPARC Products

Required fields are marked with *

0

Inquiry Basket

cartIcon