Recombinant Rabbit GHR protein, His&Myc-tagged
Cat.No. : | GHR-4274R |
Product Overview : | Recombinant Rabbit GHR protein(P19941)(19-256aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rabbit |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 19-256aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 34.6 kDa |
AA Sequence : | FSGSEATPATLGRASESVQRVHPGLGTNSSGKPKFTKCRSPELETFSCHWTDGVHHGLKSPGSVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTNNGGMVDQKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRSSEKYGEFSEVLYVTLPQMSP |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | GHR growth hormone receptor [ Oryctolagus cuniculus ] |
Official Symbol | GHR |
Synonyms | GHR; growth hormone receptor; GH receptor; somatotropin receptor; |
Gene ID | 100009325 |
mRNA Refseq | NM_001082636 |
Protein Refseq | NP_001076105 |
◆ Recombinant Proteins | ||
GHR-1623H | Active Recombinant Human GHR Protein, Fc-tagged | +Inquiry |
GHR-1836R | Active Recombinant Rabbit GHR Protein | +Inquiry |
GHR-108H | Recombinant Human GHR Protein, ECD, Tag Free, Biotinylated | +Inquiry |
Ghr-723M | Recombinant Mouse PDS5B Protein(Met 1-Gln 273), His & hFc-tagged | +Inquiry |
GHR-1279R | Acitve Recombinant Rat GHR protein(Met1-Arg265), hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GHR-1140RCL | Recombinant Rat GHR cell lysate | +Inquiry |
GHR-2401MCL | Recombinant Mouse GHR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GHR Products
Required fields are marked with *
My Review for All GHR Products
Required fields are marked with *
0
Inquiry Basket