Recombinant Full Length Rabbit Growth Hormone Receptor(Ghr) Protein, His-Tagged
Cat.No. : | RFL33516OF |
Product Overview : | Recombinant Full Length Rabbit Growth hormone receptor(GHR) Protein (P19941) (19-638aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Oryctolagus cuniculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (19-638) |
Form : | Lyophilized powder |
AA Sequence : | FSGSEATPATLGRASESVQRVHPGLGTNSSGKPKFTKCRSPELETFSCHWTDGVHHGLKSPGSVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTNNGGMVDQKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRSSEKYGEFSEVLYVTLPQMSPFTCEEDFRFPWFLIIIFGIFGLTVMLFVFIFSKQQRIKMLILPPVPVPKIKGIDPDLLKEGKLEEVNTILAIQDSYKPEFYNDDSWVEFIELDIDDPDEKTEGSDTDRLLSNSHQKSLSVLAAKDDDSGRTSCYEPDILENDFNASDGCDGNSEVAQPQRLKGEADLLCLDQKNQNNSPYHDVSPAAQQPEVVLAEEDKPRPLLTGEIESTLQAAPSQLSNPNSLANIDFYAQVSDITPAGSVVLSPGQKNKAGNSQCDAHPEVVSLCQTNFIMDNAYFCEADAKKCIAVAPHVDVESRVEPSFNQEDIYITTESLTTTAERSGTAEDAPGSEMPVPDYTSIHLVQSPQGLVLNAATLPLPDKEFLSSCGYVSTDQLNKILP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GHR |
Synonyms | GHR; Growth hormone receptor; GH receptor; Somatotropin receptor |
UniProt ID | P19941 |
◆ Recombinant Proteins | ||
Ghr-5676M | Recombinant Mouse Ghr Protein (Met1-Gln273), C-Fc tagged | +Inquiry |
GHR-2337H | Recombinant Human GHR Protein (Lys315-Thr574), N-His tagged | +Inquiry |
GHR-28186TH | Recombinant Human GHR, Fc-tagged | +Inquiry |
Ghr-723M | Recombinant Mouse PDS5B Protein(Met 1-Gln 273), His & hFc-tagged | +Inquiry |
GHR-451H | Recombinant Human GHR protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GHR-2401MCL | Recombinant Mouse GHR cell lysate | +Inquiry |
GHR-1140RCL | Recombinant Rat GHR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GHR Products
Required fields are marked with *
My Review for All GHR Products
Required fields are marked with *
0
Inquiry Basket