Active Recombinant Rat Csf1 Protein (155 aa)
Cat.No. : | Csf1-333C |
Product Overview : | Recombinant Rat Macrophage Colony Stimulating Factor (M-CSF) produced in E. coli is a disulfide-linked homodimer containing two non-glycosylated polypeptide chains of 155 amino acids each. A fully biologically active molecule, rrM-CSF has a molecular mass of 28 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Protein Length : | 155 |
Description : | Macrophage-Colony Stimulating Factor (M-CSF), also known as Colony Stimulating Factor-1 (CSF-1), can stimulate the survival, proliferation and differentiation of mononuclear phagocytes, in addition to the spreading and motility of macrophages. M-CSF is mainly produced by monocytes, macrophages, fibroblasts, and endothelial cells. Interaction of M-CSF with its receptor, c-fms, has been implicated in the growth, invasion, and metastasis of several types of cancer, including breast and endometrial cancer. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 5 ng/mL, measured in a cell proliferation assay using Murine M-NFS-60 cells, corresponding to a specific activity of > 2 × 10^5 units/mg. |
Molecular Mass : | 28 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | MEVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSLAKCSSRDVVTKP |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant Rat Macrophage Colony Stimulating Factor(M-CSF) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Rat M-CSF should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against 50mM Tris, 150mM NaCl, pH 8.0. |
Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
Gene Name | Csf1 colony stimulating factor 1 (macrophage) [ Rattus norvegicus ] |
Official Symbol | Csf1 |
Synonyms | CSF1; colony stimulating factor 1 (macrophage); macrophage colony-stimulating factor 1; MCSF; CSF-1; |
Gene ID | 78965 |
mRNA Refseq | NM_023981 |
Protein Refseq | NP_076471 |
UniProt ID | Q8JZQ0 |
◆ Recombinant Proteins | ||
CSF1-1962H | Recombinant Human CSF1 Protein, GST-tagged | +Inquiry |
CSF1-340C | Recombinant Cynomolgus/Rhesus CSF1 protein(Met1-Asn190), hFc-tagged | +Inquiry |
CSF1-565H | Active Recombinant Human CSF1 protein, His-tagged | +Inquiry |
CSF1-198H | Recombinant Human CSF1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
CSF1-96H | Recombinant Human CSF1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSF1-001MCL | Recombinant Mouse CSF1 cell lysate | +Inquiry |
CSF1-1934HCL | Recombinant Human CSF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Csf1 Products
Required fields are marked with *
My Review for All Csf1 Products
Required fields are marked with *
0
Inquiry Basket