Recombinant Rat Il1b protein

Cat.No. : Il1b-93R
Product Overview : Recombinant Rat Il1b protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : Non
Protein Length : 153
Description : Interleukin-1beta (IL-1β) is a non-secreted proinflammatory cytokine produced mainly by activated macrophages, as well as neutrophils, epithelial cells, and endothelial cells. It possesses metabolic, physiological, haematopoietic activities, and plays one of the central roles in the regulation of the immune responses. Both IL-1αand IL-1β binds to the same receptor and has similar but not identical biological properties. The mature rat IL1β shares 90 % a.a. sequence identity with cotton rat and mouse and 65 % to 77 % with canine, human,and rhesus IL1β.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4, with 5 % trehalose, 0.02 % Tween-20.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine D10S cells is less than 0.1 ng/ml, corresponding to a specific activity of > 1.0 × 10⁷ IU/mg.
Molecular Mass : Approximately 17.3 kDa, a single non-glycosylated polypeptide chain containing 153 amino acids.
AA Sequence : MVPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS
Endotoxin : Less than 1 EU/µg of rRtIL-1β as determined by LAL method.
Purity : >96% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Il1b
Official Symbol Il1b
Synonyms Catabolin, Leukocyte Endogenous Mediator, LEM, Lymphocyte-activating factor, LAF, Mononuclear Cell Factor, MCF , Endogenous Pyrogen, EP
Gene ID 24494
mRNA Refseq NM_031512
Protein Refseq NP_113700
UniProt ID Q63264

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il1b Products

Required fields are marked with *

My Review for All Il1b Products

Required fields are marked with *

0

Inquiry Basket

cartIcon