Recombinant Rhesus macaque EpCAM Protein, His-tagged

• Cat.No.: EpCAM-225R
• Product Overview: Recombinant Rhesus macaque EpCAM protein with His tag was expressed in HEK293.

Specification

• Species: Rhesus macaque
• Source: HEK293
• Tag: His
• Protein Length: 314
• Description: This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy.
• Form: Lyophilized
• Molecular Mass: 28.2 kDa
• AA Sequence: MAPPQVLAFGLLLAAATASFAAAQKECVCENYKLAVNCFLNDNGQCQCTSIGAQNTVLCSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDVQSLRTALEEAIKTRYQLDPKFITNILYEDNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLRVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAIVAGIVVLVISRKKRMAKYEKAEIKEMGEIHRELNA
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: EPCAM epithelial cell adhesion molecule [ Macaca mulatta (Rhesus monkey) ]
• Official Symbol: EpCAM
• Synonyms: EPCAM; epithelial cell adhesion molecule; tumor-associated calcium signal transducer 1; Ep-CAM; TACSTD1
• Gene ID: 677680
• mRNA Refseq: NM_001040029
• Protein Refseq: NP_001035118
• UniProt ID: Q1WER1