Recombinant Streptomyces avidinii Streptavidin, His tagged, Cys Labeled

Cat.No. : Streptavidin-07
Product Overview : Cys Labeled recombinant Streptavidin with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Streptomyces avidinii
Source : E.coli
Tag : His
Conjugation/Label : N-Cys
Description : Cysteine-streptavidin (Cys-streptavidin) is an engineered streptavidin that contains a cysteine residue at the n-terminus. Cysteine-streptavidin has four identical subunits and binds specifically to biotin with an extremely high affinity. In addition, the unique cysteine residue offers site-specific conjugation. Hence, cysteine-streptavidin can create a conjugate with an optimum molar ratio. Moreover, the cys-streptavidin protein has a C-terminal polyhistidine tag to purify streptavidin and conjugates under mild conditions.
Form : Liquid
Molecular Mass : 17.9 kDa (Monomer)
AA Sequence : DPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
Biotin binding Site : 4
Dissociation Constant : 10^-14 mol/L
Elution : Neutral pH (PBS-imidazole)
Purity : ≥ 95% by SDS-PAGE
Applications : In vitro research use only Features • High affinity for biotin • High specificity for biotin • Site-specific conjugation due to the single cysteine • Mild purification due to the 8 × His tag Site-specific conjugation of Cysteine-streptavidin (His-tag) • Enzyme (HRP, phosphatase, beta-galactosidase, luciferase, glucose oxidase) • Dye (FITC, Cy5, Cy3, Alexa, ATTO, DyLight) • Fluorescent protein (R-PE, B-PE, APC, PerCP, GFP, RFP) • Oligonucleotide • Solid support (agarose, gold particle)
Storage : Short Term Storage: -20 centigrade Long Term Storage: -20 centigrade Avoid freeze/thaw cycle. Aliquot upon arrival.
Storage Buffer : 20 mM HEPES, 0.5 mM TCEP, pH7.0
Concentration : > 2.0 mg/mL
Shipping : Cold packs
Synonyms Streptavidin
UniProt ID P22629

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Streptavidin Products

Required fields are marked with *

My Review for All Streptavidin Products

Required fields are marked with *

0
cart-icon