Recombinant Streptomyces avidinii Streptavidin, His tagged, Cys Labeled
Cat.No. : | Streptavidin-07 |
Product Overview : | Cys Labeled recombinant Streptavidin with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Streptomyces avidinii |
Source : | E.coli |
Tag : | His |
Conjugation/Label : | N-Cys |
Description : | Cysteine-streptavidin (Cys-streptavidin) is an engineered streptavidin that contains a cysteine residue at the n-terminus. Cysteine-streptavidin has four identical subunits and binds specifically to biotin with an extremely high affinity. In addition, the unique cysteine residue offers site-specific conjugation. Hence, cysteine-streptavidin can create a conjugate with an optimum molar ratio. Moreover, the cys-streptavidin protein has a C-terminal polyhistidine tag to purify streptavidin and conjugates under mild conditions. |
Form : | Liquid |
Molecular Mass : | 17.9 kDa (Monomer) |
AA Sequence : | DPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ |
Biotin binding Site : | 4 |
Dissociation Constant : | 10^-14 mol/L |
Elution : | Neutral pH (PBS-imidazole) |
Purity : | ≥ 95% by SDS-PAGE |
Applications : | In vitro research use only Features • High affinity for biotin • High specificity for biotin • Site-specific conjugation due to the single cysteine • Mild purification due to the 8 × His tag Site-specific conjugation of Cysteine-streptavidin (His-tag) • Enzyme (HRP, phosphatase, beta-galactosidase, luciferase, glucose oxidase) • Dye (FITC, Cy5, Cy3, Alexa, ATTO, DyLight) • Fluorescent protein (R-PE, B-PE, APC, PerCP, GFP, RFP) • Oligonucleotide • Solid support (agarose, gold particle) |
Storage : | Short Term Storage: -20 centigrade Long Term Storage: -20 centigrade Avoid freeze/thaw cycle. Aliquot upon arrival. |
Storage Buffer : | 20 mM HEPES, 0.5 mM TCEP, pH7.0 |
Concentration : | > 2.0 mg/mL |
Shipping : | Cold packs |
Official Symbol | Streptavidin |
Synonyms | Streptavidin |
UniProt ID | P22629 |
◆ Recombinant Proteins | ||
Streptavidin-929S | Streptavidin(nitrocellulose-binding,Liquid) | +Inquiry |
Streptavidin-930S | Streptavidin(C-line) | +Inquiry |
Streptavidin-2939S | Core Streptavidin | +Inquiry |
Streptavidin-501 | Recombinant streptavidin | +Inquiry |
Streptavidin-5117S | Active Recombinant Streptomyces avidinii Streptavidin | +Inquiry |
◆ Native Proteins | ||
Streptavidin-05S | Active Native Streptomyces avidinii Streptavidin | +Inquiry |
Streptavidin-24 | Streptavidin | +Inquiry |
Streptavidin-016 | Native Streptomyces avidinii Streptavidin, Gold conjugated | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Streptavidin Products
Required fields are marked with *
My Review for All Streptavidin Products
Required fields are marked with *
0
Inquiry Basket