| Species : |
Human |
| Source : |
E.coli |
| Tag : |
His |
| Protein Length : |
1-323 aa |
| Description : |
This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reduction of prostaglandin (PG) D2, PGH2 and phenanthrenequinone (PQ), and the oxidation of 9alpha,11beta-PGF2 to PGD2. It may play an important role in the pathogenesis of allergic diseases such as asthma, and may also have a role in controlling cell growth and/or differentiation. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. Three transcript variants encoding different isoforms have been found for this gene. |
| Form : |
Liquid |
| Molecular Mass : |
39 kDa (343aa) confirmed by MALDI-TOF |
| AA Sequence : |
< MGSSHHHHHHSSGLVPRGSH> MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY |
| Bio-Activity : |
Specific activity is > 1,000 pmol/min/μg, and is defined as the amount of enzyme that catalyze the oxidation of 1.0 pmole 1-Acenaphthenol in the presence of NADP per minute at pH 8.8 at 25 centigrade. |
| Endotoxin : |
< 1 EU/μg by LAL. |
| Purity : |
> 95 % by SDS-PAGE |
| Applications : |
SDS-PAGE, Enzyme Activity |
| Storage : |
Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
| Storage Buffer : |
20mM Tris-HCl buffer (pH 8.0) containing 10 % glycerol |
| Concentration : |
1 mg/mL (determined by Bradford assay) |
| Reference : |
1. Davies N., et al. (2009) Cancer Res. 69(11):4769-75
2. Kabututu Z., et al. (2009) J Biochem. 145(2):161-8 |
