| Species : |
Human |
| Source : |
HEK293 |
| Tag : |
Non |
| Description : |
Amphiregulin is an epidermal growth factor (EGF)-related glycoprotein that is expressed in a variety of tissues including ovary, placenta, lung, kidney, stomach, colon and breast. As an EGF-related growth factor, Amphiregulin is involved in the differentiation and proliferation of a wide range of cell types and these actions are mediated through binding to the EGF receptor. |
| Amino Acid Sequence : |
VVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMK. |
| Molecular Mass : |
Under reducing conditions Amphiregulin (mature form) migrates as a broad band between 17.6 and 23.4 kDa on SDS-PAGE due to post-translational modifications, in particular glycosylation. This compares with unmodified Amphiregulin polypeptide that has a predicted monomeric molecular mass of 9.07 kDa. |
| % Carbohydrate : |
Purified Amphiregulin (mature form) consists of 25–50% carbohydrate by weight. |
| Glycosylation : |
Amphiregulin (mature form) contains N- and O-linked oligosaccharides. |
| Purity : |
>95%, as determined by SDS-PAGE, visualized by Coomassie Brilliant Blue. |
| Formulation : |
When reconstituted in 0.5 ml sterile 5mM acetic acid, the solution will contain 1% human serum albumin (HSA) and 10% trehalose. |
| Reconstitution : |
It is recommended that 0.5 ml of sterile 5mM acetic acid be added to the vial. |
| Storage : |
Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not recommended. |
| Activity : |
The ED50of Amphiregulin (mature form) is typically 10–15 ng/ml as measured in a cell proliferation assay using the murine Balb/3T3 fibroblast cell line. |
| Publications : |
|
