Active Recombinant Human Amphiregulin

Cat.No. : AREG-134H
Product Overview : Recombinant Human Amphiregulin encoding the human Amphiregulin protein sequence (containing the signal peptide, N- and C-terminal propeptide and the mature Amphiregulin sequence) was expressed in modifiedhuman 293 cells. Proteolytic processing of the expressed membrane-bound precursor protein generates mature soluble Amphiregulin.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Non
Description : Amphiregulin is an epidermal growth factor (EGF)-related glycoprotein that is expressed in a variety of tissues including ovary, placenta, lung, kidney, stomach, colon and breast. As an EGF-related growth factor, Amphiregulin is involved in the differentiation and proliferation of a wide range of cell types and these actions are mediated through binding to the EGF receptor.
Amino Acid Sequence : VVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMK.
Molecular Mass : Under reducing conditions Amphiregulin (mature form) migrates as a broad band between 17.6 and 23.4 kDa on SDS-PAGE due to post-translational modifications, in particular glycosylation. This compares with unmodified Amphiregulin polypeptide that has a predicted monomeric molecular mass of 9.07 kDa.
% Carbohydrate : Purified Amphiregulin (mature form) consists of 25–50% carbohydrate by weight.
Glycosylation : Amphiregulin (mature form) contains N- and O-linked oligosaccharides.
Purity : >95%, as determined by SDS-PAGE, visualized by Coomassie Brilliant Blue.
Formulation : When reconstituted in 0.5 ml sterile 5mM acetic acid, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Reconstitution : It is recommended that 0.5 ml of sterile 5mM acetic acid be added to the vial.
Storage : Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Activity : The ED50of Amphiregulin (mature form) is typically 10–15 ng/ml as measured in a cell proliferation assay using the murine Balb/3T3 fibroblast cell line.
Publications :
Gene Name EG amphiregulin [ Homo sapiens ]
Synonyms AREG; amphiregulin; AR; SDGF; CRDGF; MGC13647; schwannoma-derived growth factor; colorectum cell-derived growth factor; OTTHUMP00000160473
Gene ID 374
mRNA Refseq NM_001657
Protein Refseq NP_001648
UniProt ID P15514
Chromosome Location 4q13-q21
MIM 104640
Pathway ErbB signaling pathway
Function cytokine activity; growth factor activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AREG Products

Required fields are marked with *

My Review for All AREG Products

Required fields are marked with *

0
cart-icon
0
compare icon