Active Recombinant Human Amphiregulin

• Cat.No.: AREG-134H
• Product Overview: Recombinant Human Amphiregulin encoding the human Amphiregulin protein sequence (containing the signal peptide, N- and C-terminal propeptide and the mature Amphiregulin sequence) was expressed in modifiedhuman 293 cells. Proteolytic processing of the expressed membrane-bound precursor protein generates mature soluble Amphiregulin.

Specification

• Species: Human
• Source: HEK293
• Tag: Non
• Description: Amphiregulin is an epidermal growth factor (EGF)-related glycoprotein that is expressed in a variety of tissues including ovary, placenta, lung, kidney, stomach, colon and breast. As an EGF-related growth factor, Amphiregulin is involved in the differentiation and proliferation of a wide range of cell types and these actions are mediated through binding to the EGF receptor.
• Amino Acid Sequence: VVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMK.
• Molecular Mass: Under reducing conditions Amphiregulin (mature form) migrates as a broad band between 17.6 and 23.4 kDa on SDS-PAGE due to post-translational modifications, in particular glycosylation. This compares with unmodified Amphiregulin polypeptide that has a predicted monomeric molecular mass of 9.07 kDa.
• % Carbohydrate: Purified Amphiregulin (mature form) consists of 25–50% carbohydrate by weight.
• Glycosylation: Amphiregulin (mature form) contains N- and O-linked oligosaccharides.
• Purity: >95%, as determined by SDS-PAGE, visualized by Coomassie Brilliant Blue.
• Formulation: When reconstituted in 0.5 ml sterile 5mM acetic acid, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
• Reconstitution: It is recommended that 0.5 ml of sterile 5mM acetic acid be added to the vial.
• Storage: Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
• Activity: The ED₅₀of Amphiregulin (mature form) is typically 10–15 ng/ml as measured in a cell proliferation assay using the murine Balb/3T3 fibroblast cell line.
• Publications:
  Epidermal Growth Factor Receptor (EGFR) Signaling Is a Key Mediator of Hormone-Induced Leukocyte Infiltration in the Pubertal Female Mammary Gland (2014)

Gene Information

• Gene Name: EG amphiregulin [ Homo sapiens ]
• Synonyms: AREG; amphiregulin; AR; SDGF; CRDGF; MGC13647; schwannoma-derived growth factor; colorectum cell-derived growth factor; OTTHUMP00000160473
• Gene ID: 374
• mRNA Refseq: NM_001657
• Protein Refseq: NP_001648
• UniProt ID: P15514
• Chromosome Location: 4q13-q21
• MIM: 104640
• Pathway: ErbB signaling pathway
• Function: cytokine activity; growth factor activity