Active Recombinant Human CCL20 Protein (70 aa)
Cat.No. : | CCL20-073C |
Product Overview : | Recombinant Human CCL20 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 70 |
Description : | MIP-3 alpha/CCL20, also known as LARC (Liver and Activation-regulated Chemokine) and as Exodus, is a CC chemokine that is expressed in the liver, lymph nodes, appendix, PBL and lung and can signal through the CCR6 receptor. MIP-3 alpha is chemotactic towards lymphocytes and dendritic cells. Additionally, it promotes the adhesion of memory CD4+ T cells and inhibits colony formation of bone marrow myeloid immature progenitors. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Fully biologically active when compared to standard. Determined by its ability to chemoattract human T lymphocytes using a concentration range of 10.0 -50.0 ng/mL, corresponding to a Specific Activity of >2 × 10^4 IU/mg. |
Molecular Mass : | 8.0 kDa, a single non-glycosylated polypeptide chain containing 70 amino acids. |
AA Sequence : | ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM |
Endotoxin : | Less than 1 EU/mg of rHuMIP-3a/CCL20 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 100mM NaCl. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | CCL20 chemokine (C-C motif) ligand 20 [ Homo sapiens ] |
Official Symbol | CCL20 |
Synonyms | CCL20; chemokine (C-C motif) ligand 20; SCYA20, small inducible cytokine subfamily A (Cys Cys), member 20; C-C motif chemokine 20; CKb4; exodus 1; LARC; MIP 3a; ST38; exodus-1; MIP-3-alpha; CC chemokine LARC; beta chemokine exodus-1; beta-chemokine exodus-1; small-inducible cytokine A20; macrophage inflammatory protein 3 alpha; liver and activation-regulated chemokine; small inducible cytokine subfamily A (Cys-Cys), member 20; MIP3A; MIP-3a; SCYA20; |
Gene ID | 6364 |
mRNA Refseq | NM_001130046 |
Protein Refseq | NP_001123518 |
MIM | 601960 |
UniProt ID | P78556 |
◆ Recombinant Proteins | ||
CCL20-512R | Recombinant Rhesus Macaque CCL20 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCL20-296H | Active Recombinant Human CCL20 | +Inquiry |
Ccl20-2032M | Active Recombinant Mouse Ccl20 Protein | +Inquiry |
CCL20-870R | Recombinant Rat CCL20 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCL20-0624H | Recombinant Human CCL20 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL20-447MCL | Recombinant Mouse CCL20 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCL20 Products
Required fields are marked with *
My Review for All CCL20 Products
Required fields are marked with *
0
Inquiry Basket