Active Recombinant Human CSF2 Protein

Cat.No. : CSF2-155C
Product Overview : Recombinant Human Granulocyte Macrophage Colony Stimulating Factor (rhGM-CSF) produced in P. pastoris a glycosylated polypeptide. A fully biologically active molecule, rhGM-CSF has a molecular mass of 26-32 kDa analyzed by SDS-PAGE and is obtained by proprietary refolding and chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : P.pastoris
Description : Human Granulocyte Macrophage Colony Stimulating Factor (hGM-CSF), a hematopoietic growth factor, is mainly involved in granulopoiesis and monocytopoiesis. It is produced by T-cells and macrophages in response to antigens, and by endothelial cells and fibroblasts following induction of variouscytokines. A monomeric protein of 127 amino acidswith six glycosylation sites and two intra disulfide bonds, glycosylated and non-glycosylated hGM-CSFs show similar biological activities. Other than its connection to the growth and development of granulocytes and macrophages, it is also indispensable for the proliferation of erythroid and megakaryocytic cells.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50< 0.2 ng/mL, measured by proliferation assay of TF-1 cells, corresponding to a specific activity of > 56 units/mg.
Molecular Mass : 26-32kDa, observed by SDS-PAGE.
AA Sequence : MAPARSPSPSTQPWEHVNAIQEALRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Endotoxin : < 1 EU/μg, determined by LAL method.
Purity : > 95 % as analyzed by SDS-PAGE.
Storage : Lyophilized recombinant human Granulocyte Macrophage Colony Stimulating Factor (rhGM-CSF) remains stable up to 12 months at -80 centigrade from date of receipt. Upon reconstitution, rhGM-CSF should be stable up to 4 weeks at 4 centigrade or up to 6 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against 10 mM PB, pH7.0.
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name CSF2 colony stimulating factor 2 (granulocyte-macrophage) [ Homo sapiens ]
Official Symbol CSF2
Synonyms CSF2; colony stimulating factor 2 (granulocyte-macrophage); granulocyte-macrophage colony-stimulating factor; GM CSF; GMCSF; granulocyte macrophage colony stimulating factor; molgramostin; sargramostim; CSF; colony-stimulating factor; granulocyte-macrophage colony stimulating factor; MGC131935; MGC138897;
Gene ID 1437
mRNA Refseq NM_000758
Protein Refseq NP_000749
MIM 138960
UniProt ID P04141

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CSF2 Products

Required fields are marked with *

My Review for All CSF2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon