Active Recombinant Human CSF2, His tagged, Animal Free
Cat.No. : | CSF2-88H |
Product Overview : | Human recombinant protein expressed in Nicotiana benthamiana. It is produced by transient expression in non-transgenic plants and is purified by sequential chromatography (FPLC). rHuman GM-CSF is a glycosilated polypeptide chain containing 127 amino acids (18-144 aa CSF2_HUMAN P04141), fused to 10 His tag at N-terminal. This product contains no animal-derived components or impurities. Animal Free product. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Nicotiana Benthamiana |
Tag : | His |
Description : | GMCSF is a cytokine that stimulate the growth and differentiation of hematopoietic precursor cells from various lineages, such as granulocytes, macrophages, eosinophils and erythrocytes. Is involved in differentiation of dendritic cells and is a key factor in differentiation pathways leading form stem cells. GMCSF is produced by several cell types as monocytes, fibroblast, endothelial cells and T-Lymphocytes in response to a number of inflammatory mediators present in the hemopoietic environment and peripheral site of inflammation. Human GMCF is an important therapeutic cytokine used in the treatment of myeloid leukemia, neutropenia and aplastic anemia and it could become interesting in the treatment following bone marrow transplantation. It performs biological activity by binding to a receptor specific receptor complex which is composed of a cytokine-specific alpha chain and beta chain shared with the receptors for interleukin-3 and interleukin-5. GMCSR has been identified to mediate the activation of Jak-Stat and MAPK pathways. |
Form : | Recombinant human GM-CSF is lyophilized from 10mM PBS buffer pH 7.6 and 0.2 M NaCl. |
Bio-activity : | Biological Activity:1. Effect of GM-CSF on human TF-1 cells;2. Effect of GM-CSF on kerotino cytesmigration (HaCaT cells); 3. Collagen I expression profile performed on keratinocytes (HaCaT cells); 4. Effect of GM-CSF on Human fibroblast cell proliferation. |
Molecular Mass : | Between 15 and 25 kDa due to post-translation modification, in particular glycosilation. |
AA Sequence : | HHHHHHHHHHAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQG LRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIFDCWEPVQE |
Endotoxin : | < 0.04="" eu/μg="" protein="" (lal=""> |
Purity : | >97% by SDS-PAGE gel |
Applications : | Cell culture. Western Blot. Immunogen. Dermocosmetics (rh CFS stimulates fibroblast cell proliferation, kerotinocytes migration (HaCaT cells) and induces Collagen I expression in keratinocytes). |
Stability : | Lyophilized protein remains stable until the expiry date when stored at –20°C. |
Storage : | Store lyophilized protein at –20°C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80°C for long term storage. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after one week at 4°C. |
Reconstitution : | Lyophilized protein should be reconstituted in water following instructions of batch Quality Control sheet. At higher concentrations the solubility may be reduced and multimers generated. Optimal concentration should be determined for specific application. |
Gene Name | CSF2 colony stimulating factor 2 (granulocyte-macrophage) [ Homo sapiens ] |
Official Symbol | CSF2 |
Synonyms | CSF2; colony stimulating factor 2 (granulocyte-macrophage); granulocyte-macrophage colony-stimulating factor; GM CSF; GMCSF; granulocyte macrophage colony stimulating factor; molgramostin; sargramostim; CSF; colony-stimulating factor; granulocyte-macrophage colony stimulating factor; MGC131935; MGC138897; |
Gene ID | 1437 |
mRNA Refseq | NM_000758 |
Protein Refseq | NP_000749 |
MIM | 138960 |
UniProt ID | P04141 |
Chromosome Location | 5q23-q31 |
Pathway | Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; Calcium signaling in the CD4+ TCR pathway, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; |
Function | cytokine activity; granulocyte macrophage colony-stimulating factor receptor binding; growth factor activity; protein binding; |
◆ Recombinant Proteins | ||
CSF2-220H | Recombinant Human CSF2, StrepII-tagged | +Inquiry |
Csf2-94R | Recombinant Rat Csf2 protein | +Inquiry |
CSF2-03H | Active Recombinant Human CSF2 protein | +Inquiry |
CSF2-23H | Active Recombinant Human CSF2 | +Inquiry |
CSF2-27474TH | Recombinant Human CSF2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSF2-3008HCL | Recombinant Human CSF2 cell lysate | +Inquiry |
CSF2-740RCL | Recombinant Rat CSF2 cell lysate | +Inquiry |
CSF2-1008MCL | Recombinant Mouse CSF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CSF2 Products
Required fields are marked with *
My Review for All CSF2 Products
Required fields are marked with *
0
Inquiry Basket