Active Recombinant Human CXCL1 Protein
Cat.No. : | CXCL1-272C |
Product Overview : | Recombinant Human CXCL1 Protein without tag was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | CHO |
Description : | GRO/MGSA/CXCL1 has chemotactic activity for neutrophils. It may play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. All three isoforms of GRO are CXC chemokines that can signal through the CXCR1 or CXCR2 receptors. GRO expression is inducible by serum or PDGF and/or by a variety of inflammatory mediators, such as IL-1 and TNF, in monocytes, fibroblasts, melanocytes and epithelial cells. In certain tumor cell lines, GRO is expressed constitutively. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Active, measured in a functional assay using HUVEC cells. |
Molecular Mass : | ~7.8 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant Human GRO/MGSA/CXCL1 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human GRO/MGSA/CXCL1 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | CXCL1 chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) [ Homo sapiens ] |
Official Symbol | CXCL1 |
Synonyms | CXCL1; chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha); fibroblast secretory protein, FSP, GRO1, GRO1 oncogene (melanoma growth stimulating activity, alpha), MGSA; growth-regulated alpha protein; GROa; MGSA a; NAP 3; SCYB1; MGSA alpha; GRO-alpha(1-73); C-X-C motif chemokine 1; fibroblast secretory protein; neutrophil-activating protein 3; melanoma growth stimulatory activity alpha; GRO1 oncogene (melanoma growth-stimulating activity); GRO1 oncogene (melanoma growth stimulating activity, alpha); FSP; GRO1; MGSA; NAP-3; MGSA-a; |
Gene ID | 2919 |
mRNA Refseq | NM_001511 |
Protein Refseq | NP_001502 |
MIM | 155730 |
UniProt ID | P09341 |
◆ Recombinant Proteins | ||
CXCL1-3779H | Recombinant Human CXCL1 protein, rFc-tagged | +Inquiry |
Cxcl1-387C | Active Recombinant Cotton Rat Cxcl1 | +Inquiry |
Cxcl1-96M | Recombinant Mouse Cxcl1 protein | +Inquiry |
CXCL1-162H | Recombinant Human Chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha), MBP-tagged | +Inquiry |
Cxcl1-529M | Recombinant Mouse Cxcl1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CXCL1-27707TH | Native Human CXCL1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL1-425HCL | Recombinant Human CXCL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL1 Products
Required fields are marked with *
My Review for All CXCL1 Products
Required fields are marked with *