Active Recombinant Rat Cxcl1 Protein (72 aa)

Cat.No. : Cxcl1-011C
Product Overview : Recombinant Rat Cxcl1 Protein (72 aa) without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Protein Length : 72
Description : All three isoforms of GRO are CXC chemokines that can signal through the CXCR1 or CXCR2 receptors. The GRO proteins chemoattract and activate neutrophils and basophils.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : Fully biologically active when compared to standard. Determined by its ability to chemoattract rat neutrophils using a concentration range of 10.0-100.0 ng/mL, corresponding to a Specific Activity of >1 × 10^4 IU/mg.
Molecular Mass : 7.8 kDa, a single, non-glycosylated polypeptide chain containing 72 amino acids.
AA Sequence : APVANELRCQCLQTVAGIHFKNIQSLKVMPPGPHCTQTEVIATLKNGREACLDPEAPMVQKIVQKMLKGVPK
Endotoxin : Less than 1 EU/μg of rRtGRO/CXCL1 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analyses.
Storage : This lyophilized preparation is stable for several weeks at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
Storage Buffer : Lyophilized from a 0.2 μm filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at < -20C. Further dilutions should be made in appropriate buffered solutions.
Gene Name Cxcl1 chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) [ Rattus norvegicus ]
Official Symbol Cxcl1
Synonyms CXCL1; chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha); growth-regulated alpha protein; gro; C-X-C motif chemokine 1; cytokine-induced neutrophil chemoattractant 1; platelet-derived growth factor-inducible protein KC; Gro1; CINC-1;
Gene ID 81503
mRNA Refseq NM_030845
Protein Refseq NP_110472
UniProt ID G3V6C6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Cxcl1 Products

Required fields are marked with *

My Review for All Cxcl1 Products

Required fields are marked with *

0
cart-icon
0
compare icon