Active Recombinant Rat Cxcl1 Protein (72 aa)
| Cat.No. : | Cxcl1-011C |
| Product Overview : | Recombinant Rat Cxcl1 Protein (72 aa) without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Protein Length : | 72 |
| Description : | All three isoforms of GRO are CXC chemokines that can signal through the CXCR1 or CXCR2 receptors. The GRO proteins chemoattract and activate neutrophils and basophils. |
| Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : | Fully biologically active when compared to standard. Determined by its ability to chemoattract rat neutrophils using a concentration range of 10.0-100.0 ng/mL, corresponding to a Specific Activity of >1 × 10^4 IU/mg. |
| Molecular Mass : | 7.8 kDa, a single, non-glycosylated polypeptide chain containing 72 amino acids. |
| AA Sequence : | APVANELRCQCLQTVAGIHFKNIQSLKVMPPGPHCTQTEVIATLKNGREACLDPEAPMVQKIVQKMLKGVPK |
| Endotoxin : | Less than 1 EU/μg of rRtGRO/CXCL1 as determined by LAL method. |
| Purity : | >97% by SDS-PAGE and HPLC analyses. |
| Storage : | This lyophilized preparation is stable for several weeks at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
| Storage Buffer : | Lyophilized from a 0.2 μm filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at < -20C. Further dilutions should be made in appropriate buffered solutions. |
| Gene Name | Cxcl1 chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) [ Rattus norvegicus ] |
| Official Symbol | Cxcl1 |
| Synonyms | CXCL1; chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha); growth-regulated alpha protein; gro; C-X-C motif chemokine 1; cytokine-induced neutrophil chemoattractant 1; platelet-derived growth factor-inducible protein KC; Gro1; CINC-1; |
| Gene ID | 81503 |
| mRNA Refseq | NM_030845 |
| Protein Refseq | NP_110472 |
| UniProt ID | G3V6C6 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cxcl1 Products
Required fields are marked with *
My Review for All Cxcl1 Products
Required fields are marked with *



