Active Recombinant Human EGF Protein (53 aa)
Cat.No. : | EGF-429E |
Product Overview : | Recombinant human Epidermal Growth Factor (EGF) is a 6,200 Da protein containing 53 amino acid residues. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 53 |
Description : | Epidermal Growth Factor (EGF) is a polypeptide growth factor which stimulates the proliferation of a wide range of epidermal and epithelial cells. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | The ED50, calculated by the dose-dependant proliferation of murine BALB/c 3T3 cells is less then 2 ng/mL, corresponding to a specific activity of 5.0 × 10^5 IU/mg. |
Molecular Mass : | 6.0 kDa+/-10% determined by reduced SDS-PAGE |
AA Sequence : | MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR |
Endotoxin : | Less than 0.1 ng/μg (1 EU/μg) of recombinant human Epidermal Growth Factor (EGF) as determined by LAL test. |
Purity : | Greater than 95% as determined by (a) Analysis by SEC-HPLC (b) Analysis by reducing and non-reducing SDS-PAGE Silver Stained gel |
Storage : | Lyophilized recombinant Human Epidermal Growth Factor (rhEGF) remains stable up to 12 months at -80 centigrade from date of receipt. Upon reconstitution, rhEGF should be stable up to 4 weeks at 4 centigrade or up to 6 months at -20 centigrade. |
Storage Buffer : | Recombinant human Epidermal Growth Factor (EGF) was lyophilized after extensive dialysis against 10mM Phosphate buffer, pH7.0, 200mM NaCl buffer. |
Reconstitution : | It is recommended to reconstitute the lyophilized recombinant human Epidermal Growth Factor (EGF) in sterile 18 MΩ-cm H2O not less than 100 μg/mL, which can then be further diluted to other aqueous solutions. |
Gene Name | EGF epidermal growth factor [ Homo sapiens ] |
Official Symbol | EGF |
Synonyms | EGF; epidermal growth factor; epidermal growth factor (beta urogastrone); pro-epidermal growth factor; beta-urogastrone; URG; HOMG4; |
Gene ID | 1950 |
mRNA Refseq | NM_001178130 |
Protein Refseq | NP_001171601 |
MIM | 131530 |
UniProt ID | P01133 |
◆ Recombinant Proteins | ||
EGF-2036H | Recombinant Human EGF Protein (Ala609-Gly751), His tagged | +Inquiry |
Egf-631M | Active Recombinant Mouse Egf | +Inquiry |
EGF-866M | Recombinant Mouse Epidermal Growth Factor, His-tagged | +Inquiry |
EGF-4071H | Recombinant Human EGF Protein (Asn971-His1024), C-His tagged | +Inquiry |
EGF-3113H | Recombinant Human EGF Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
EGF-26462TH | Native Human EGF | +Inquiry |
Egf -634M | Active Native Mouse Egf protein | +Inquiry |
Egf-635R | Native Rat Egf | +Inquiry |
EGF-23H | Active Native Human EGF protein | +Inquiry |
Egf -635R | Native Rat Egf protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EGF-973MCL | Recombinant Mouse EGF cell lysate | +Inquiry |
EGF-2716HCL | Recombinant Human EGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EGF Products
Required fields are marked with *
My Review for All EGF Products
Required fields are marked with *