Recombinant Human EGF protein(1061-1140 aa), C-His-tagged
| Cat.No. : | EGF-2507H |
| Product Overview : | Recombinant Human EGF protein(P01133)(1061-1140 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1061-1140 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Molecular Mass : | 10.5 kDa |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | KLLSKNPKNPYEESSRDVRSRRPADTEDGMSSCPQPWFVVIKEHQDLKNGGQPVAGEDGQAADGSMQPTSWRQEPQLCGM |
| Gene Name | EGF epidermal growth factor [ Homo sapiens ] |
| Official Symbol | EGF |
| Synonyms | EGF; epidermal growth factor; epidermal growth factor (beta urogastrone); pro-epidermal growth factor; beta-urogastrone; URG; HOMG4; |
| Gene ID | 1950 |
| mRNA Refseq | NM_001178130 |
| Protein Refseq | NP_001171601 |
| MIM | 131530 |
| UniProt ID | P01133 |
| ◆ Recombinant Proteins | ||
| EGF-214H | Recombinant Human EGF, StrepII-tagged | +Inquiry |
| EGF-7474H | Recombinant Human EGF protein | +Inquiry |
| EGF-6H | Active Recombinant Human Epidermal Growth Factor | +Inquiry |
| EGF-06H | Recombinant Human epidermal growth factor Protein, Tag Free, Animal Free | +Inquiry |
| EGF-01HG | Active GMP Recombinant Human EGF Protein | +Inquiry |
| ◆ Native Proteins | ||
| Egf -635R | Native Rat Egf protein | +Inquiry |
| EGF-23H | Active Native Human EGF protein | +Inquiry |
| Egf -634M | Active Native Mouse Egf protein | +Inquiry |
| EGF-26462TH | Native Human EGF | +Inquiry |
| Egf-634M | Active Native Mouse Egf | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EGF-973MCL | Recombinant Mouse EGF cell lysate | +Inquiry |
| EGF-2716HCL | Recombinant Human EGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EGF Products
Required fields are marked with *
My Review for All EGF Products
Required fields are marked with *
