Active Recombinant Human FGF10 Protein (169 aa)

• Cat.No.: FGF10-421F
• Product Overview: Recombinant Human FGF-10 produced in E. coli is a single, non-glycosylated polypeptide chain containing 169 amino acids. A fully biologically active molecule, rhFGF-10 has a molecular mass of 19.3 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 169
• Description: Fibroblast Growth Factor-10 (FGF-10) is a mitogen mainly produced by mesenchymal stem cells in the lung. FGF-10 belongs to the heparin binding FGF family, and is also known as Keratinocyte Growth Factor-2 (KGF-2). It shares homology with KGF and receptor binding to FGFR2-IIIb. However, while KGF induces proliferation and differentiation of various epithelial cells, FGF-10 promotes budding and branching morphogenesis during the multi-organ development via mesenchymal-epithelial cell interactions. FGF-10 is critical for lung and limb development, and is regulated by Shh during early development.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 20 ng/mL, measured by a cell proliferation assay using 4 MBr-5 cells, corresponding to a specific activity of > 5.0 × 10^4 units/mg.
• Molecular Mass: 19.3 kDa, observed by reducing SDS-PAGE.
• AA Sequence: LGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE.
• Storage: Lyophilized recombinant Human FGF-10 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human FGF-10 should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Gene Name: FGF10 fibroblast growth factor 10 [ Homo sapiens ]
• Official Symbol: FGF10
• Synonyms: FGF10; fibroblast growth factor 10; FGF-10; keratinocyte growth factor 2; produced by fibroblasts of urinary bladder lamina propria
• Gene ID: 2255
• mRNA Refseq: NM_004465
• Protein Refseq: NP_004456
• MIM: 602115
• UniProt ID: O15520