Species : |
Human |
Source : |
E.coli |
Tag : |
Non |
Description : |
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein exhibits mitogenic activity for keratinizing epidermal cells, but essentially no activity for fibroblasts, which is similar to the biological activity of FGF7. Studies of the mouse homolog of suggested that this gene is required for embryonic epidermal morphogenesis including brain development, lung morphogenesis, and initiation of lim bud formation. This gene is also implicated to be a primary factor in the process of wound healing. [provided by RefSeq |
Form : |
Lyophilized |
Bio-activity : |
The ED50 was determined by the dose-dependent proliferation of BaF3 cells expressing FGF receptors, and was found to be <0.5 ng/mL., corresponding to a specific activity of 2.0 x 106 units/mg. |
Molecular Mass : |
19 kDa |
AA Sequence : |
MWKWILTHCASAFPHLPGCCCCCFLLLFLVSSVPVTCQALGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS |
Endotoxin : |
< 0.1 ng/μg (1 EU/μg) |
Purity : |
> 90% by SDS-PAGE and HPLC |
Applications : |
Functional Study SDS-PAGE |
Storage : |
Store at -20 centigrade on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4 centigrade for 1 month or store at -20 centigrade for 6 months. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : |
Lyophilized from PBS, pH 7.0 |