Recombinant Human FGF10 protein, GST-tagged
| Cat.No. : | FGF10-2904H | 
| Product Overview : | Recombinant Human FGF10 protein(O15520)(38-208aa), fused to N-terminal GST tag, was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | GST | 
| Protein Length : | 38-208aa | 
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. | 
| Molecular Mass : | 46.3 kDa | 
| AA Sequence : | QALGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS | 
| Purity : | Greater than 90% as determined by SDS-PAGE. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. | 
| Gene Name | FGF10 fibroblast growth factor 10 [ Homo sapiens ] | 
| Official Symbol | FGF10 | 
| Synonyms | FGF10; fibroblast growth factor 10; FGF-10; keratinocyte growth factor 2; produced by fibroblasts of urinary bladder lamina propria; | 
| Gene ID | 2255 | 
| mRNA Refseq | NM_004465 | 
| Protein Refseq | NP_004456 | 
| MIM | 602115 | 
| UniProt ID | O15520 | 
| ◆ Recombinant Proteins | ||
| FGF10-422F | Active Recombinant Human FGF10 Protein (187 aa), N-His-tagged | +Inquiry | 
| FGF10-1515R | Recombinant Rhesus Macaque FGF10 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| FGF10-15H | Active Recombinant Human FGF10 protein | +Inquiry | 
| FGF10-6262C | Recombinant Chicken FGF10 Protein, His tagged | +Inquiry | 
| FGF10-267C | Recombinant Cynomolgus Monkey FGF10 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| FGF10-6251HCL | Recombinant Human FGF10 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF10 Products
Required fields are marked with *
My Review for All FGF10 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            