Active Recombinant Human FGF21 Protein (182 aa)
Cat.No. : | FGF21-120F |
Product Overview : | Recombinant Human FGF21 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 182 |
Description : | Fibroblast growth factor 21 (FGF21) belongs to the large FGF family which has at least 23 members. All FGF family members are heparin binding growth factors with a core 120 amino acid (aa) FGF domain that allows for a common tertiary structure. FGFs are expressed during embryonic development and in restricted adult tissues. Four distinct but related classes of FGF receptors, FGF R1, 2, 3, and 4, exist. FGF-21, in the presence of betaKlotho as a protein cofactor, signals through the FGFR 1c and 4 receptors and stimulates insulin independent glucose uptake by adipocytes. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by the dose-dependent stimulation of the proliferation of BaF3 cells expressing FGF receptors is 0.06-0.4 μg/mL in the presence of betaKlotho and Heparin, corresponding to a Specific Activity of >2.5× 10^3 IU/mg. |
Molecular Mass : | Approximately 19.5 kDa, a single non-glycosylated polypeptide chain containing 182 amino acids. |
AA Sequence : | MHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS |
Endotoxin : | Less than 1 EU/mg of rHuFGF-21 as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable for several weeks at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | FGF21 fibroblast growth factor 21 [ Homo sapiens ] |
Official Symbol | FGF21 |
Synonyms | FGF21; fibroblast growth factor 21; FGF-21; |
Gene ID | 26291 |
mRNA Refseq | NM_019113 |
Protein Refseq | NP_061986 |
MIM | 609436 |
UniProt ID | Q9NSA1 |
◆ Recombinant Proteins | ||
Fgf21-7399M | Recombinant Mouse Fgf21 Protein, His-tagged | +Inquiry |
Fgf21-256M | Recombinant Mouse Fgf21, FLAG-tagged | +Inquiry |
FGF21-1567H | Recombinant Human FGF21 protein, mFc-Avi-tagged, Biotinylated | +Inquiry |
FGF21-562H | Recombinant Human FGF21 protein | +Inquiry |
Fgf21-2997M | Recombinant Mouse Fgf21 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF21-1890MCL | Recombinant Mouse FGF21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGF21 Products
Required fields are marked with *
My Review for All FGF21 Products
Required fields are marked with *
0
Inquiry Basket