Active Recombinant Human FGF21 Protein (182 aa)

Cat.No. : FGF21-120F
Product Overview : Recombinant Human FGF21 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 182
Description : Fibroblast growth factor 21 (FGF21) belongs to the large FGF family which has at least 23 members. All FGF family members are heparin binding growth factors with a core 120 amino acid (aa) FGF domain that allows for a common tertiary structure. FGFs are expressed during embryonic development and in restricted adult tissues. Four distinct but related classes of FGF receptors, FGF R1, 2, 3, and 4, exist. FGF-21, in the presence of betaKlotho as a protein cofactor, signals through the FGFR 1c and 4 receptors and stimulates insulin independent glucose uptake by adipocytes.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by the dose-dependent stimulation of the proliferation of BaF3 cells expressing FGF receptors is 0.06-0.4 μg/mL in the presence of betaKlotho and Heparin, corresponding to a Specific Activity of >2.5× 10^3 IU/mg.
Molecular Mass : Approximately 19.5 kDa, a single non-glycosylated polypeptide chain containing 182 amino acids.
AA Sequence : MHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Endotoxin : Less than 1 EU/mg of rHuFGF-21 as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analyses.
Storage : This lyophilized preparation is stable for several weeks at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
Storage Buffer : Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name FGF21 fibroblast growth factor 21 [ Homo sapiens ]
Official Symbol FGF21
Synonyms FGF21; fibroblast growth factor 21; FGF-21;
Gene ID 26291
mRNA Refseq NM_019113
Protein Refseq NP_061986
MIM 609436
UniProt ID Q9NSA1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGF21 Products

Required fields are marked with *

My Review for All FGF21 Products

Required fields are marked with *

0
cart-icon