"FGF21" Related Products

Expand
Expand

Recombinant Human FGF21 Protein, GST-tagged

Cat.No. : FGF21-4111H
Product Overview : Human FGF21 full-length ORF ( AAH18404, 30 a.a. - 209 a.a.) recombinant protein with GST-tag at N-terminal.
Description : The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The function of this growth factor has not yet been determined. [provided by RefSeq
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 45.54 kDa
AA Sequence : PIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing :

12.5% SDS-PAGE Stained with Coomassie Blue.

Gene Name : FGF21 fibroblast growth factor 21 [ Homo sapiens ]
Official Symbol : FGF21
Synonyms : FGF21; fibroblast growth factor 21; FGF-21;
Gene ID : 26291
mRNA Refseq : NM_019113
Protein Refseq : NP_061986
MIM : 609436
UniProt ID : Q9NSA1

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.