Active Recombinant Human FGF9 Protein (207 aa)
Cat.No. : | FGF9-119F |
Product Overview : | Recombinant Human FGF9 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 207 |
Description : | Fibroblast growth factor 9 (FGF9) belongs to the large FGF family which has at least 23 members. All FGF family members are heparin binding growth factors with a core 120 amino acid (aa) FGF domain that allows for a common tertiary structure. FGF-9 targets glial cells, astrocytes cells and other cells that express the FGFR 1c, 2c, 3b, 3c, and 4. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by the dose-dependent stimulation of thymidine uptake by BaF3 cells expressing FGF receptors is ≤0.5 ng/mL, corresponding to a specific activity of ≥ 2 × 10^6 units/mg. |
Molecular Mass : | Approximately 23.4 kDa, a single non-glycosylated polypeptide chain containing 207 amino acids. |
AA Sequence : | APLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS |
Endotoxin : | Less than 1 EU/mg of rHuFGF-9 as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable for several weeks at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | FGF9 fibroblast growth factor 9 (glia-activating factor) [ Homo sapiens ] |
Official Symbol | FGF9 |
Synonyms | FGF9; fibroblast growth factor 9 (glia-activating factor); fibroblast growth factor 9; FGF-9; HBGF-9; heparin-binding growth factor 9; GAF; SYNS3; HBFG-9; MGC119914; MGC119915; |
Gene ID | 2254 |
mRNA Refseq | NM_002010 |
Protein Refseq | NP_002001 |
MIM | 600921 |
UniProt ID | P31371 |
◆ Recombinant Proteins | ||
Fgf9-669M | Recombinant Mouse Fgf9 protein | +Inquiry |
FGF9-96R | Recombinant Rat FGF9 Protein | +Inquiry |
Fgf9-586R | Active Recombinant Rat Fgf9 | +Inquiry |
FGF9-3022H | Recombinant Human FGF9 Protein (Met1-Ser208), His tagged | +Inquiry |
FGF9-406F | Active Recombinant Human FGF9 Protein (208 aa) | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF9-001CCL | Recombinant Canine FGF9 cell lysate | +Inquiry |
FGF9-2955HCL | Recombinant Human FGF9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGF9 Products
Required fields are marked with *
My Review for All FGF9 Products
Required fields are marked with *
0
Inquiry Basket