Active Recombinant Human FGF9 Protein (208 aa)
Cat.No. : | FGF9-406F |
Product Overview : | Recombinant Human Fibroblast Growth Factor-9(rhFGF-9) produced in E. coli is a single non-glycosylated polypeptide chain containing 208 amino acids. A fully biologically active molecule, rhFGF-9 has a molecular mass of 23.4 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 208 |
Description : | Fibroblast Growth Factor-9 (FGF-9) is a heparin binding growth factor that belongs to the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. FGF-9 was isolated as a secreted factor that exhibits a growth-stimulating effect on cultured glial cells. In nervous system, this protein is produced mainly by neurons and may be important for glial cell development. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 2.0 ng/mL, measured by a cell proliferation assay using 3T3 cells, corresponding to a specific activity of >5.0 × 10^5 units/mg. |
Molecular Mass : | 23.4 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% by SDS-PAGE and HPLC analyses. |
Storage : | Lyophilized recombinant Human Fibroblast Growth Factor-9(rhFGF-9) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhFGF-9 should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
Gene Name | FGF9 fibroblast growth factor 9 (glia-activating factor) [ Homo sapiens ] |
Official Symbol | FGF9 |
Synonyms | FGF9; fibroblast growth factor 9 (glia-activating factor); fibroblast growth factor 9; FGF-9; HBGF-9; heparin-binding growth factor 9; GAF; SYNS3; HBFG-9; MGC119914; MGC119915; |
Gene ID | 2254 |
mRNA Refseq | NM_002010 |
Protein Refseq | NP_002001 |
MIM | 600921 |
UniProt ID | P31371 |
◆ Recombinant Proteins | ||
FGF9-186H | Recombinant Human FGF9 protein, His/S-tagged | +Inquiry |
FGF9-4117H | Recombinant Human FGF9 Protein, GST-tagged | +Inquiry |
Fgf9-586R | Active Recombinant Rat Fgf9 | +Inquiry |
FGF9-647H | Recombinant Human FGF9 protein, His-tagged | +Inquiry |
Fgf9-669M | Recombinant Mouse Fgf9 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF9-2955HCL | Recombinant Human FGF9 cell lysate | +Inquiry |
FGF9-001CCL | Recombinant Canine FGF9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGF9 Products
Required fields are marked with *
My Review for All FGF9 Products
Required fields are marked with *
0
Inquiry Basket