| Species : |
Human |
| Source : |
E.coli |
| Protein Length : |
208 |
| Description : |
Fibroblast Growth Factor-9 (FGF-9) is a heparin binding growth factor that belongs to the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. FGF-9 was isolated as a secreted factor that exhibits a growth-stimulating effect on cultured glial cells. In nervous system, this protein is produced mainly by neurons and may be important for glial cell development. |
| Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : |
ED50 < 2.0 ng/mL, measured by a cell proliferation assay using 3T3 cells, corresponding to a specific activity of >5.0 × 10^5 units/mg. |
| Molecular Mass : |
23.4 kDa, observed by reducing SDS-PAGE. |
| AA Sequence : |
MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS |
| Endotoxin : |
< 0.2 EU/μg, determined by LAL method. |
| Purity : |
> 95% by SDS-PAGE and HPLC analyses. |
| Storage : |
Lyophilized recombinant Human Fibroblast Growth Factor-9(rhFGF-9) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhFGF-9 should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
| Storage Buffer : |
Lyophilized after extensive dialysis against PBS. |
| Reconstitution : |
Reconstituted in ddH2O at 100 μg/mL. |