Active Recombinant Human IL1A Protein (159 aa)

Cat.No. : IL1A-102I
Product Overview : Recombinant Human IL1A Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 159
Description : IL-1 alpha is a non-secreted proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1alpha and IL-1beta binds to the same receptor and has similar if not identical biological properties. These cytokines have a broad range of activities including, stimulation of thymocyte proliferation, by inducing IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity and the ability to stimulate the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1beta is a secreted cytokine, IL-1alpha is predominantly a cell-associated cytokine.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant stimulation of murine D10S cells is less then 0.001 ng/mL, corresponding to a Specific Activity of >1 × 10^9 IU/mg.
Molecular Mass : Approximately 18.0 kDa, a single non-glycosylated polypeptide chain containing 159 amino acids.
AA Sequence : SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
Endotoxin : Less than 1 EU/μg of rHuIL-1α as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analyses.
Storage : This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
Storage Buffer : Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.5.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20C. Further dilutions should be made in appropriate buffered solutions.
Gene Name IL1A interleukin 1, alpha [ Homo sapiens ]
Official Symbol IL1A
Synonyms IL1A; interleukin 1, alpha; IL1; interleukin-1 alpha; hematopoietin 1; IL 1A; IL1 ALPHA; IL1F1; preinterleukin 1 alpha; pro interleukin 1 alpha; IL-1 alpha; hematopoietin-1; pro-interleukin-1-alpha; IL-1A; IL1-ALPHA;
Gene ID 3552
mRNA Refseq NM_000575
Protein Refseq NP_000566
MIM 147760
UniProt ID P01583

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL1A Products

Required fields are marked with *

My Review for All IL1A Products

Required fields are marked with *

0
cart-icon