Active Recombinant Human IL21 Protein (132 aa)
Cat.No. : | IL21-362I |
Product Overview : | Recombinant human Interleukin-21 (rhIL-21) produced in E. coli is a single non-glycosylated polypeptide chain containing 132 amino acids. A fully biologically active molecule, rhIL-21 has a molecular mass of 15.4 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 132 |
Description : | Interleukin-21 (IL-21) belongs to the Type I four helix bundle cytokines, and shares the common cytokine receptor γ chain with IL-2, IL-4, IL-7, IL-9, and IL-15. IL-21 is expressed by CD4+ T cells, natural killer (NK) T cells, and Th17 cells, and the IL-21 receptor is highly expressed on CD4+ and CD8+ B cells; indeed, IL-21 plays a pivotal role in the survival and proliferation of B cells, and their differentiation to immunoglobulin (Ig) producing cells. IL-21 up-regulates and down-regulates the production of IgG1 and IgE by B cells, respectively, and diminishes the severity of allergy and asthma. In some case, IL-21 also induces the apoptosis of B cells. The other roles of IL-21 include regulation of innate immune systems, implication on autoimmunity, and antitumor actions. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 0.5 ng/mL, measured by a cell growth inhibition assay using Mino cells, corresponding to a specific activity of > 2.0 × 10^6 units/mg. |
Molecular Mass : | 15.4 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | MQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% by SDS-PAGE analysis. |
Storage : | Lyophilized recombinant human Interleukin-21 (rhIL-21) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhIL-21 should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
Gene Name | IL21 interleukin 21 [ Homo sapiens ] |
Official Symbol | IL21 |
Synonyms | IL21; interleukin 21; interleukin-21; IL 21; Za11; interleukin-21 isoform; IL-21; |
Gene ID | 59067 |
mRNA Refseq | NM_001207006 |
Protein Refseq | NP_001193935 |
MIM | 605384 |
UniProt ID | Q9HBE4 |
◆ Recombinant Proteins | ||
Il21-187M | Active Recombinant Mouse interleukin 21 Protein, Tag Free | +Inquiry |
il21-4335S | Recombinant Salmon il21 Protein | +Inquiry |
IL21-3378R | Active Recombinant Rat IL21 protein(Met1-Ser146), His-tagged | +Inquiry |
Il21-001H | Active Recombinant Human Il21, HIgG1 Fc-tagged, mutant | +Inquiry |
IL21-2220H | Recombinant Human IL21 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL21-001RCL | Recombinant Rat IL21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL21 Products
Required fields are marked with *
My Review for All IL21 Products
Required fields are marked with *
0
Inquiry Basket