Active Recombinant Human IL21 Protein (132 aa)

Cat.No. : IL21-362I
Product Overview : Recombinant human Interleukin-21 (rhIL-21) produced in E. coli is a single non-glycosylated polypeptide chain containing 132 amino acids. A fully biologically active molecule, rhIL-21 has a molecular mass of 15.4 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 132
Description : Interleukin-21 (IL-21) belongs to the Type I four helix bundle cytokines, and shares the common cytokine receptor γ chain with IL-2, IL-4, IL-7, IL-9, and IL-15. IL-21 is expressed by CD4+ T cells, natural killer (NK) T cells, and Th17 cells, and the IL-21 receptor is highly expressed on CD4+ and CD8+ B cells; indeed, IL-21 plays a pivotal role in the survival and proliferation of B cells, and their differentiation to immunoglobulin (Ig) producing cells. IL-21 up-regulates and down-regulates the production of IgG1 and IgE by B cells, respectively, and diminishes the severity of allergy and asthma. In some case, IL-21 also induces the apoptosis of B cells. The other roles of IL-21 include regulation of innate immune systems, implication on autoimmunity, and antitumor actions.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 0.5 ng/mL, measured by a cell growth inhibition assay using Mino cells, corresponding to a specific activity of > 2.0 × 10^6 units/mg.
Molecular Mass : 15.4 kDa, observed by reducing SDS-PAGE.
AA Sequence : MQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% by SDS-PAGE analysis.
Storage : Lyophilized recombinant human Interleukin-21 (rhIL-21) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhIL-21 should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name IL21 interleukin 21 [ Homo sapiens ]
Official Symbol IL21
Synonyms IL21; interleukin 21; interleukin-21; IL 21; Za11; interleukin-21 isoform; IL-21;
Gene ID 59067
mRNA Refseq NM_001207006
Protein Refseq NP_001193935
MIM 605384
UniProt ID Q9HBE4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL21 Products

Required fields are marked with *

My Review for All IL21 Products

Required fields are marked with *

0
cart-icon