Active Recombinant Human IL22 Protein (146 aa)
Cat.No. : | IL22-098I |
Product Overview : | Recombinant Human IL22 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 146 |
Description : | IL-22 is a member of the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences, but they are dissimilar in their biological functions. Produced by T lymphocytes, IL-22 inhibits IL-4 production by Th2 cells, and induces acute phase reactants in the liver and pancreas. IL-22 signals through a receptor system consisting of IL-10R-β/CRF2-4 and IL-22R, both of which are members of the class II cytokine-receptor family. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Determined by its ability to activate STAT following receptor ligand interaction. |
Molecular Mass : | Approximately 33.6 kDa,non-disulfide-linked homodimeric protein containing of two 146 amino acid polypeptide chains. |
AA Sequence : | MAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI |
Endotoxin : | Less than 1 EU/mg of rHuIL-22 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 5.0. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | IL22 interleukin 22 [ Homo sapiens ] |
Official Symbol | IL22 |
Synonyms | IL22; interleukin 22; interleukin-22; IL 10 related T cell derived inducible factor; IL 21; IL 22; IL D110; IL TIF; ILTIF; MGC79382; MGC79384; TIFa; TIFIL 23; zcyto18; cytokine Zcyto18; IL-10-related T-cell-derived inducible factor; IL-10-related T-cell-derived-inducible factor; IL-21; IL-22; IL-TIF; IL-D110; TIFIL-23; |
Gene ID | 50616 |
mRNA Refseq | NM_020525 |
Protein Refseq | NP_065386 |
MIM | 605330 |
UniProt ID | Q9GZX6 |
◆ Recombinant Proteins | ||
Il22-178M | Recombinant Active Mouse IL22 Protein, His-tagged(C-ter) | +Inquiry |
IL22-73H | Recombinant Human IL22 Protein | +Inquiry |
IL22-342H | Recombinant Human IL22, Fc-tagged | +Inquiry |
IL22-002H | Active Recombinant Human IL22 Protein, His-tagged | +Inquiry |
IL22-2926Z | Recombinant Zebrafish IL22 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL22-5232HCL | Recombinant Human IL22 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL22 Products
Required fields are marked with *
My Review for All IL22 Products
Required fields are marked with *
0
Inquiry Basket