Active Recombinant Human LR3IGF1 Protein (Receptor Grade)
Cat.No. : | IGF1-339I |
Product Overview : | Recombinant Human LR3IGF1 Protein (Receptor Grade) without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | IGF-1 is a well-characterized basic peptide secreted by the liver that circulates in the blood. It has growth-regulating, insulin-like, mitogenic activities. IGF-1 is a growth factor that has a major, but not absolute, dependence on somatotropin. It is believed to be mainly active in adults in contrast to IGF-2, which is also a major fetal growth factor. Human Long R3 Insulin-like Growth Factor-1 (rhLR3IGF-1) contains an 83 amino acid analog of human IGF-I. Compared to the complete human IGF-I sequence, an addition of the rhLR3IGF-1 includes the substitution of an Arg for the Glu at position 3 (hence R3)and a13 amino acid extension peptide at the N-terminus. An enhanced potency is due to the markedly decreased binding of human Long-R3-IGF-I to IGF binding proteins which normally inhibit the biological actions of IGFs. RhLR3IGF-1 is properly folded under oxidizing conditions and then purified by proprietary chromatographic techniques. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 10 ng/mL, measured by the dose-dependantproliferation of CHO cells, corresponding to a specific activity of >1.0 × 10^5 units/mg. |
Molecular Mass : | 9.1±0.9 KDa, observed by reducing SDS-PAGE. |
AA Sequence : | MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
Endotoxin : | < 1 EU/μg, determined by LAL method. |
Purity : | > 95% by SDS-PAGE. |
Storage : | Lyophilized recombinant human Long R3Insulin-like Growth Factor-1 (rhLR3IGF-1) remains stable up to 6 months at -80 centigrade from date of receipt. Stock solution of peptide can be stored at least 3 months at -20 centigrade. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Lyophilized after dissolved in 48%acetonitrile and 0.1% TFA |
Reconstitution : | Reconstituted in 10mM HCl at 1mg/ml. Use a 0.22 μm membrane for filter Sterilization. |
Gene Name | IGF1 insulin like growth factor 1 [ Homo sapiens (human) ] |
Official Symbol | IGF1 |
Synonyms | IGF1; insulin like growth factor 1; IGF; MGF; IGFI; IGF-I; insulin-like growth factor I; insulin-like growth factor 1 (somatomedin C); insulin-like growth factor IB; mechano growth factor; somatomedin-C |
Gene ID | 3479 |
mRNA Refseq | NM_000618 |
Protein Refseq | NP_000609 |
MIM | 147440 |
UniProt ID | P05019 |
◆ Recombinant Proteins | ||
Igf1-01B | Recombinant Bovine Igf1 Protein | +Inquiry |
IGF1-4121H | Recombinant Human IGF1 protein, GST-tagged | +Inquiry |
IGF1-809C | Recombinant Chicken IGF1 protein, His & GST-tagged | +Inquiry |
IGF1-4460M | Recombinant Mouse IGF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
IGF1-84G | Recombinant Gilthead Seabream Insulin-Like Growth Factor 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGF1-5268HCL | Recombinant Human IGF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IGF1 Products
Required fields are marked with *
My Review for All IGF1 Products
Required fields are marked with *
0
Inquiry Basket