Species : |
Human |
Source : |
E.coli |
Description : |
IGF-1 is a well-characterized basic peptide secreted by the liver that circulates in the blood. It has growth-regulating, insulin-like, mitogenic activities. IGF-1 is a growth factor that has a major, but not absolute, dependence on somatotropin. It is believed to be mainly active in adults in contrast to IGF-2, which is also a major fetal growth factor. Human Long R3 Insulin-like Growth Factor-1 (rhLR3IGF-1) contains an 83 amino acid analog of human IGF-I. Compared to the complete human IGF-I sequence, an addition of the rhLR3IGF-1 includes the substitution of an Arg for the Glu at position 3 (hence R3)and a13 amino acid extension peptide at the N-terminus. An enhanced potency is due to the markedly decreased binding of human Long-R3-IGF-I to IGF binding proteins which normally inhibit the biological actions of IGFs. RhLR3IGF-1 is properly folded under oxidizing conditions and then purified by proprietary chromatographic techniques. |
Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : |
ED50 < 10 ng/mL, measured by the dose-dependantproliferation of CHO cells, corresponding to a specific activity of >1.0 × 10^5 units/mg. |
Molecular Mass : |
9.1±0.9 KDa, observed by reducing SDS-PAGE. |
AA Sequence : |
MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
Endotoxin : |
< 1 EU/μg, determined by LAL method. |
Purity : |
> 95% by SDS-PAGE. |
Storage : |
Lyophilized recombinant human Long R3Insulin-like Growth Factor-1 (rhLR3IGF-1) remains stable up to 6 months at -80 centigrade from date of receipt. Stock solution of peptide can be stored at least 3 months at -20 centigrade. Avoid repeated freeze-thaw cycles. |
Storage Buffer : |
Lyophilized after dissolved in 48%acetonitrile and 0.1% TFA |
Reconstitution : |
Reconstituted in 10mM HCl at 1mg/ml. Use a 0.22 μm membrane for filter Sterilization. |