Active Recombinant Human IGF1 Protein
Cat.No. : | IGF1-137H |
Product Overview : | Recombinant Human LR3 Insulin-Like Growth Factor-I is produced by our E.coli expression system and the target gene encoding Gly49-Ala118 is expressed. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | Gly49-Ala118 |
Description : | Insulin-like growth factor I (IGF1) belongs to the family of insulin-like growth factors that are structurally homologous to proinsulin. Mature IGFs are generated by proteolytic processing of inactive precursor proteins, which contains the N- and C-terminal propeptide regions. Mature human IGF-I consisting of 70 amino acids has 94% identity with mouse IGF-I and exhibits cross-species activity. IGF-1 binds IGF-IR, IGF-IIR, and the insulin receptor and plays a key role in cell cycle progression, cell proliferation and tumor progression. IGF-1 expression is regulated by growth hormone. R3 IGF-1 is an 83 amino acid analog of IGF-1 comprising the complete human IGF-1 sequence with the substitution of an Arg (R) for the Glu(E) at position three, hence R3, and a 13 amino acid extension peptide at the N terminus. R3 IGF-1 has been produced with the purpose of increasing biological activity. R3 IGF-1 is significantly more potent than human IGF-I in vitro. |
Form : | Lyophilized from a 0.2 um filtered solution of 300mM HAc-NaAc, pH 6.5. |
Bio-activity : | ED50 is greater than 200 ng/ml. Measured by an IGF binding protein assay. |
AA Sequence : | MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCD LRRLEMYCAPLKPAKSA |
Endotoxin : | Less than 0.1 ng/ug (1 EU/ug). |
Purity : | >95% |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
Quality Statement : | Purity: Greater than 95% as determined by reducing SDS-PAGE. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature listed below. |
Gene Name | IGF1 insulin like growth factor 1 [ Homo sapiens (human) ] |
Official Symbol | IGF1 |
Synonyms | Insulin-Like Growth Factor I; IGF-I; Mechano Growth Factor; MGF; Somatomedin-C; IBP1; IGF; MGF; IGFI |
Gene ID | 3479 |
mRNA Refseq | NM_000618.5 |
Protein Refseq | NP_000609.1 |
MIM | 147440 |
UniProt ID | P05019 |
◆ Recombinant Proteins | ||
IGF1-55H | Active Recombinant Human IGF1 protein (Gly49-Ala118(Glu 51 Arg)) | +Inquiry |
Igf1-128M | Recombinant Active Mouse IGF1 Protein, His-tagged(C-ter) | +Inquiry |
IGF1-8063M | Recombinant Mouse IGF1 Protein | +Inquiry |
IGF1-3928H | Recombinant Human IGF1 protein | +Inquiry |
IGF1-986D | Recombinant Dog IGF1 Protein, His&GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGF1-5268HCL | Recombinant Human IGF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IGF1 Products
Required fields are marked with *
My Review for All IGF1 Products
Required fields are marked with *
0
Inquiry Basket