Recombinant Human IGF1 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | IGF1-020H |
Product Overview : | IGF1 MS Standard C13 and N15-labeled recombinant protein (NP_000609) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is similar to insulin in function and structure and is a member of a family of proteins involved in mediating growth and development. The encoded protein is processed from a precursor, bound by a specific receptor, and secreted. Defects in this gene are a cause of insulin-like growth factor I deficiency. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar processing to generate mature protein. |
Molecular Mass : | 17.03 kDa |
AA Sequence : | MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKEVHLKNASRGSAGNKNYRMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | IGF1 insulin like growth factor 1 [ Homo sapiens (human) ] |
Official Symbol | IGF1 |
Synonyms | IGF1; insulin like growth factor 1; IGF; IGF-I; IGFI; MGF; insulin-like growth factor I; insulin-like growth factor 1 (somatomedin C); insulin-like growth factor IB; mechano growth factor; somatomedin-C |
Gene ID | 3479 |
mRNA Refseq | NM_000618 |
Protein Refseq | NP_000609 |
MIM | 147440 |
UniProt ID | P05019 |
◆ Recombinant Proteins | ||
IGF1-126H | Recombinant Active Human IGF1 Protein, Fc-His-tagged(C-ter) | +Inquiry |
IGF1-60H | Active Recombinant Human IGF1 protein(Gly49-Ala118) | +Inquiry |
IGF1-2505H | Recombinant Human IGF1 Protein (Gly49-Ala118), C-His tagged | +Inquiry |
Igf1-01B | Recombinant Bovine Igf1 Protein | +Inquiry |
IGF1-4644B | Recombinant Bovine IGF1 protein, hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGF1-5268HCL | Recombinant Human IGF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGF1 Products
Required fields are marked with *
My Review for All IGF1 Products
Required fields are marked with *