Recombinant Human IGF1 Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : IGF1-020H
Product Overview : IGF1 MS Standard C13 and N15-labeled recombinant protein (NP_000609) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is similar to insulin in function and structure and is a member of a family of proteins involved in mediating growth and development. The encoded protein is processed from a precursor, bound by a specific receptor, and secreted. Defects in this gene are a cause of insulin-like growth factor I deficiency. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar processing to generate mature protein.
Molecular Mass : 17.03 kDa
AA Sequence : MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKEVHLKNASRGSAGNKNYRMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name IGF1 insulin like growth factor 1 [ Homo sapiens (human) ]
Official Symbol IGF1
Synonyms IGF1; insulin like growth factor 1; IGF; IGF-I; IGFI; MGF; insulin-like growth factor I; insulin-like growth factor 1 (somatomedin C); insulin-like growth factor IB; mechano growth factor; somatomedin-C
Gene ID 3479
mRNA Refseq NM_000618
Protein Refseq NP_000609
MIM 147440
UniProt ID P05019

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IGF1 Products

Required fields are marked with *

My Review for All IGF1 Products

Required fields are marked with *

0
cart-icon
0
compare icon