Active Recombinant Human NOG Protein (206 aa)
Cat.No. : | NOG-066N |
Product Overview : | Recombinant Human NOG Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 206 |
Description : | Noggin belongs to a group of diffusible proteins which bind to ligands of the TGF-β family and regulate their activity by inhibiting their access to signaling receptors. Noggin was originally identified as a BMP-4 antagonist whose action is critical for proper formation of the head and other dorsal structures. Consequently, Noggin has been shown to modulate the activities of other BMPs including BMP-2,-7,-13, and -14. Targeted deletion of Noggin in mice results in prenatal death and recessive phenotype displaying a severely malformed skeletal system. Conversely, transgenic mice over-expressing Noggin in mature osteoblasts display impaired osteoblastic differentiation, reduced bone formation, and severe osteoporosis. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | The ED50 was determined by its ability to inhibit 5.0 ng/mL of BMP-4 induced alkaline phosphatase production by ATDC-5 chondrogenic cells. The expected ED50 for this effect is 0.05-0.08 μg/mL of NOGGIN, corresponding to a Specific Activity of >1.25 × 10^4 IU/mg. |
Molecular Mass : | Approximately 46.2 kDa non-disulfide-linked homodimer consisting of two 206 amino acid polypeptide chains. |
AA Sequence : | MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC |
Endotoxin : | Less than 1 EU/μg of rHu NOGGIN as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2μm filtered concentrated solution in 30% acetonitrile, 0.1% TFA. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 10mM HAc to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | NOG noggin [ Homo sapiens ] |
Official Symbol | NOG |
Synonyms | NOG; noggin; SYM1, symphalangism 1 (proximal), synostoses (multiple) syndrome 1, SYNS1; symphalangism 1 (proximal); SYM1; SYNS1; |
Gene ID | 9241 |
mRNA Refseq | NM_005450 |
Protein Refseq | NP_005441 |
MIM | 602991 |
UniProt ID | Q13253 |
◆ Recombinant Proteins | ||
NOG-454H | Recombinant Human Noggin | +Inquiry |
NOG-27H | Recombinant Human NOG Protein | +Inquiry |
NOG-319D | Recombinant Dog NOG Protein, His-tagged | +Inquiry |
NOG-2850H | Recombinant Human NOG protein(28-232 aa), N-MBP & C-His-tagged | +Inquiry |
Nog-4452M | Active Recombinant Mouse Nog Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NOG-2414HCL | Recombinant Human NOG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NOG Products
Required fields are marked with *
My Review for All NOG Products
Required fields are marked with *
0
Inquiry Basket