Active Recombinant Mouse Nog Protein
Cat.No. : | Nog-212N |
Product Overview : | Recombinant Mouse Nog Protein without tag was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | CHO |
Description : | Noggin, also known as NOG, is a homodimeric glycoprotein that binds to and modulates the activity of TGF-beta family ligands. It is expressed in condensing cartilage and immature chondrocytes. Noggin antagonizes bone morphogenetic protein (BMP) activities by blocking epitopes on BMPs needed for binding to their receptors.Noggin has been shown to be involved in many developmental processes, such as neural tube formation and joint formation. During development, Noggin diffuses through extracellular matrices and forms morphogenic gradients that regulate cellular responses in a concentration-dependent manner. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50< 60 ng/mL, measured in a bioassay using ATDC5 cells in the presence of 10 ng/mL human BMP-4. |
Molecular Mass : | 29-31 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | LRAAPAGGQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant murine Nogginremains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, murine Nogginshould be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | Nog noggin [ Mus musculus ] |
Official Symbol | Nog |
Synonyms | NOG; noggin; |
Gene ID | 18121 |
mRNA Refseq | NM_008711 |
Protein Refseq | NP_032737 |
UniProt ID | P97466 |
◆ Recombinant Proteins | ||
NOG-2745H | Active Recombinant Human Noggin | +Inquiry |
Nog-6342M | Recombinant Mouse Nog protein, His-tagged, For Organoid Culture | +Inquiry |
NOG-315H | Active Recombinant Human NOG Protein (Gln28-Cys232), C-Fc tagged, Animal-free, Carrier-free | +Inquiry |
NOG-213N | Active Recombinant Human NOG Protein | +Inquiry |
NOG-1993H | Recombinant Human NOG protein, His-tagged, Animal-Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
NOG-2414HCL | Recombinant Human NOG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Nog Products
Required fields are marked with *
My Review for All Nog Products
Required fields are marked with *
0
Inquiry Basket