Active Recombinant Human PDGFB Protein
Cat.No. : | PDGFB-149H |
Product Overview : | Recombinant Human Platelet-Derived Growth Factor BB is produced by our E.coli expression system and the target gene encoding Ser82-Thr190 is expressed. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | Ser82-Thr190 |
Description : | Platelet-Derived Growth Factor Subunit B (PDGFB) belongs to the PDGF/VEGF growth factor family. Platelet-derived growth factor is a potent mitogen for cells of mesenchymal origin. PDGFB can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. Mutations in this gene are associated with meningioma.Binding of PDGFB to its receptor elicits a variety of cellular responses. In addition, PDGFB is released by platelets upon wounding and plays an important role in stimulating adjacent cells to grow and thereby heals the wound. |
Form : | Lyophilized from a 0.2 um filtered solution of 4mM HCl. |
Bio-activity : | Measured in a cell proliferation assay using BALB/c 3T3 cells. The ED50 for this effect is 15-60ng/ml. |
AA Sequence : | MSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQ LRPVQVRKIEIVRKKPIF KKATVTLEDHLACKCETVAAARPVT |
Endotoxin : | Less than 0.1 ng/ug (1 EU/ug). |
Purity : | >95% |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
Quality Statement : | Purity: Greater than 95% as determined by reducing SDS-PAGE. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature listed below. |
Gene Name | PDGFB platelet derived growth factor subunit B [ Homo sapiens (human) ] |
Official Symbol | PDGFB |
Synonyms | Platelet-Derived Growth Factor Subunit B; PDGF Subunit B; Platelet-Derived Growth Factor B Chain; Platelet-Derived Growth Factor Beta Polypeptide; Proto-Oncogene c-Sis; Becaplermin; SIS; SSV; IBGC5; PDGF2; c-sis; PDGF-2 |
Gene ID | 5155 |
mRNA Refseq | NM_002608.4 |
Protein Refseq | NP_002599.1 |
MIM | 190040 |
UniProt ID | P01127 |
◆ Recombinant Proteins | ||
PDGFB-977R | Recombinant Rhesus PDGFB Protein (Ser82-Thr190), His-tagged | +Inquiry |
PDGFB-171H | Active Recombinant Human PDGFB protein, Low Endotoxin | +Inquiry |
PDGFB-661H | Recombinant Human Platelet-Derived Growth Factor Beta Polypeptide | +Inquiry |
PDGFB-209C | Active Recombinant Cynomolgus PDGFB protein(Ser82-Thr190), mFc-tagged | +Inquiry |
PDGFB-225M | Active Recombinant Mouse PDGFB Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDGFB-1321HCL | Recombinant Human PDGFB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PDGFB Products
Required fields are marked with *
My Review for All PDGFB Products
Required fields are marked with *
0
Inquiry Basket