Active Recombinant Rat Pdgfbb Protein (110 aa)
| Cat.No. : | Pdgfb-315P |
| Product Overview : | Recombinant rat Platelet-Derived Growth Factor-BB (rrPDGF-BB) produced in E. coli is a disulfide-linked homodimer containing two non-glycosylated polypeptide chains of 110 amino acids each. A fully biologically active molecule, rrPDGF-BB has a molecular mass of 24.6 kDa analyzed by non-reducing SDS-PAGE and is obtained by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Protein Length : | 110 |
| Description : | Platelet-Derived Growth Factor-BB (PDGF-BB) is one of five dimers (PDGF-AA, AB, BB, CC, and DD) formed by 4 different PDGF subunits. In vivo, PDGF-BB is mainly produced in heart and placenta, and predominantly expressed by osteoblasts, fibroblasts, smooth muscle cells, and glial cells. An inactive precursor of PDGF-BB is produced in the endoplasmic reticulum and then activated by a proprotein convertase after secretion. PDGF-BB functions in a paracrine manner and promotes organogenesis, human skeletal development, and wound healing. PDGF-BB also promotes angiogenesis, particularly in the presence of Fibroblast Growth Factor basic. Therefore, PDGF-BB and its related pathways are potential pharmacological targets. |
| Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : | ED50 < 2 ng/mL, measured by a cell proliferation assay using 3T3 Cells, corresponding to a specific activity of > 5 × 10^5 units/mg. |
| Molecular Mass : | 24.6 kDa, observed by non-reducing SDS-PAGE. |
| AA Sequence : | MSLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPVFKKATVTLEDHLACKCETVVTPRPVT |
| Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
| Purity : | > 95% by SDS-PAGE analysis. |
| Storage : | Lyophilized recombinant rat Platelet-Derived Growth Factor-BB (rrPDGF-BB) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rrPDGF-BB remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
| Storage Buffer : | Lyophilized after extensive dialysis against 20 mM acetic acid. |
| Reconstitution : | Reconstituted in 20 mM acetic acid at 100 μg/mL. |
| Gene Name | Pdgfb platelet-derived growth factor beta polypeptide [ Rattus norvegicus ] |
| Official Symbol | Pdgfb |
| Synonyms | PDGFB; platelet-derived growth factor beta polypeptide; platelet-derived growth factor subunit B; PDGF-2; pdgf protein; PDGF subunit B; platelet-derived growth factor B chain; platelet derived growth factor, B polypeptide; Platelet-derived growth factor, same as Sis (Simian sarcoma viral oncogene homologue, c-sis); platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog); SIS; c-sis; |
| Gene ID | 24628 |
| mRNA Refseq | NM_031524 |
| Protein Refseq | NP_113712 |
| UniProt ID | Q05028 |
| ◆ Recombinant Proteins | ||
| PDGFB-4385C | Recombinant Canine PDGFB Protein | +Inquiry |
| Pdgfb-4757M | Active Recombinant Mouse Pdgfb Protein | +Inquiry |
| Pdgfb-316P | Active Recombinant Mouse Pdgfbb Protein (110 aa) | +Inquiry |
| PDGFB-060P | Active Recombinant Human PDGFBB Protein (109 aa) | +Inquiry |
| PDGFB-4838H | Recombinant Human PDGFB Protein (Glu21-Ala241), C-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PDGFB-1321HCL | Recombinant Human PDGFB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Pdgfb Products
Required fields are marked with *
My Review for All Pdgfb Products
Required fields are marked with *




