Active Recombinant Mouse Pdgfbb Protein (110 aa)

Cat.No. : Pdgfb-316P
Product Overview : Recombinant mouse Platelet-Derived Growth Factor-BB (rmPDGF-BB) produced in E. coli is a disulfide-linked homodimer containing two non-glycosylated polypeptide chains of 110 amino acids each. A fully biologically active molecule, rmPDGF-BB has a molecular mass of 24.7 kDa analyzed by non-reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Protein Length : 110
Description : Platelet-Derived Growth Factor-BB (PDGF-BB) is one of five dimers (PDGF-AA, AB, BB, CC, and DD) formed by 4 different PDGF subunits. In vivo PDGF-BB is mainly produced in heart and placenta, and predominantly expressed by osteoblasts, fibroblasts, smooth muscle cells, and glial cells. An inactive precursor of PDGF-BB is produced in the endoplasmic reticulum and then activated by a proprotein convertase after secretion. PDGF-BB functions in a paracrine manner and promotes organogenesis, development of human skeleton, and wound healing. PDGF-BB also promotes angiogenesis, particularly in the presence of Fibroblast Growth Factor basic. Therefore, PDGF-BB and its related pathways are potential pharmacological targets.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 2.5 ng/mL, measured by a cell proliferation assay using 3T3 Cells, corresponding to a specific activity of > 4 × 10^5 units/mg.
Molecular Mass : 24.7 kDa, observed by non-reducing SDS-PAGE.
AA Sequence : MSLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETIVTPRPVT
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% by SDS-PAGE analysis.
Storage : Lyophilized recombinant mouse Platelet-Derived Growth Factor-BB (rmPDGF-BB) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmPDGF-BB remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against 10 mM Sodium Citrate, pH 3.0.
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name Pdgfb platelet derived growth factor, B polypeptide [ Mus musculus ]
Official Symbol Pdgfb
Synonyms PDGFB; platelet derived growth factor, B polypeptide; platelet-derived growth factor subunit B; c-sis; PDGF-2; PDGF subunit B; proto-oncogene c-Sis; platelet-derived growth factor B chain; platelet-derived growth factor beta polypeptide; Sis; PDGF-B;
Gene ID 18591
mRNA Refseq NM_011057
Protein Refseq NP_035187
UniProt ID P31240

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Pdgfb Products

Required fields are marked with *

My Review for All Pdgfb Products

Required fields are marked with *

0
cart-icon
0
compare icon