Active Recombinant Mouse Pdgfbb Protein (110 aa)
Cat.No. : | Pdgfb-316P |
Product Overview : | Recombinant mouse Platelet-Derived Growth Factor-BB (rmPDGF-BB) produced in E. coli is a disulfide-linked homodimer containing two non-glycosylated polypeptide chains of 110 amino acids each. A fully biologically active molecule, rmPDGF-BB has a molecular mass of 24.7 kDa analyzed by non-reducing SDS-PAGE and is obtained by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Protein Length : | 110 |
Description : | Platelet-Derived Growth Factor-BB (PDGF-BB) is one of five dimers (PDGF-AA, AB, BB, CC, and DD) formed by 4 different PDGF subunits. In vivo PDGF-BB is mainly produced in heart and placenta, and predominantly expressed by osteoblasts, fibroblasts, smooth muscle cells, and glial cells. An inactive precursor of PDGF-BB is produced in the endoplasmic reticulum and then activated by a proprotein convertase after secretion. PDGF-BB functions in a paracrine manner and promotes organogenesis, development of human skeleton, and wound healing. PDGF-BB also promotes angiogenesis, particularly in the presence of Fibroblast Growth Factor basic. Therefore, PDGF-BB and its related pathways are potential pharmacological targets. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 2.5 ng/mL, measured by a cell proliferation assay using 3T3 Cells, corresponding to a specific activity of > 4 × 10^5 units/mg. |
Molecular Mass : | 24.7 kDa, observed by non-reducing SDS-PAGE. |
AA Sequence : | MSLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETIVTPRPVT |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% by SDS-PAGE analysis. |
Storage : | Lyophilized recombinant mouse Platelet-Derived Growth Factor-BB (rmPDGF-BB) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmPDGF-BB remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against 10 mM Sodium Citrate, pH 3.0. |
Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
Gene Name | Pdgfb platelet derived growth factor, B polypeptide [ Mus musculus ] |
Official Symbol | Pdgfb |
Synonyms | PDGFB; platelet derived growth factor, B polypeptide; platelet-derived growth factor subunit B; c-sis; PDGF-2; PDGF subunit B; proto-oncogene c-Sis; platelet-derived growth factor B chain; platelet-derived growth factor beta polypeptide; Sis; PDGF-B; |
Gene ID | 18591 |
mRNA Refseq | NM_011057 |
Protein Refseq | NP_035187 |
UniProt ID | P31240 |
◆ Recombinant Proteins | ||
PDGFB-1175P | Recombinant Pig PDGFB Protein, His-tagged | +Inquiry |
PDGFB-149H | Active Recombinant Human PDGFB Protein | +Inquiry |
PDGFB-1174H | Recombinant Human PDGFB Protein, His-tagged | +Inquiry |
PDGFB-524H | Active Recombinant Human PDGFB | +Inquiry |
Pdgfb-315P | Active Recombinant Rat Pdgfbb Protein (110 aa) | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDGFB-1321HCL | Recombinant Human PDGFB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Pdgfb Products
Required fields are marked with *
My Review for All Pdgfb Products
Required fields are marked with *
0
Inquiry Basket