Active Recombinant Mouse Ccl11 Protein
Cat.No. : | Ccl11-128M |
Product Overview : | Purified recombinant protein of Mouse chemokine (C-C motif) ligand 11 (Ccl11) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | In response to the presence of allergens, this protein directly promotes the accumulation of eosinophils (a prominent feature of allergic inflammatory reactions), but not lymphocytes, macrophages or neutrophils. |
Bio-activity : | Murine Eotaxin was found to induce chemotaxis of purified eosinophils at concentrations ranging between 100-1000 ng/ml. |
Molecular Mass : | 8.4 kDa |
AA Sequence : | HPGSIPTSCCFIMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTPKP |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
Gene Name | Ccl11 chemokine (C-C motif) ligand 11 [ Mus musculus (house mouse) ] |
Official Symbol | Ccl11 |
Synonyms | Ccl11; chemokine (C-C motif) ligand 11; Scya11; eotaxin; eotaxin; C-C motif chemokine 11; eosinophil chemotactic protein; small chemokine (C-C motif) ligand 11; small-inducible cytokine A11 |
Gene ID | 20292 |
mRNA Refseq | NM_011330 |
Protein Refseq | NP_035460 |
UniProt ID | P48298 |
◆ Recombinant Proteins | ||
Ccl11-128M | Active Recombinant Mouse Ccl11 Protein | +Inquiry |
CCL11-08H | Recombinant Human CCL11 Protein | +Inquiry |
CCL11-225H | Recombinant Human CCL11 Protein, His-tagged | +Inquiry |
Ccl11-4329M | Recombinant Mouse Ccl11 Protein | +Inquiry |
Ccl11-620M | Recombinant Mouse Ccl11 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL11-7735HCL | Recombinant Human CCL11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ccl11 Products
Required fields are marked with *
My Review for All Ccl11 Products
Required fields are marked with *