Recombinant Mouse Ccl11 protein

Cat.No. : Ccl11-620M
Product Overview : Recombinant Mouse Ccl11 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Protein Length : 74
Description : Murine CCL11 is belonging to the CC chemokine family. CCL11 was first purified from bronchoalveolar lavage fluid of guinea pigs. It was a strong and specific eosinophil chemoattractant in vitro. It can directly chemotactic for eosinophils, but not for monocytes or neutrophils. Murine CCL11 is approximately 63 % identical at the amino acid level to human CCL11. In addition, CCL11 also shows about 60 % amino acid sequence identity to human MCPs. CCR3 has been identified to be a specific CCL11 receptor.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using purified eosinophils is in a concentration range of 100-1000 ng/ml.
Molecular Mass : Approximately 8.4 kDa, a single non-glycosylated polypeptide chain containing 74 amino acids.
AA Sequence : HPGSIPTSCCFIMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTPKP
Endotoxin : Less than 1 EU/μg of rMuEotaxin/CCL11 as determined by LAL method.
Purity : >96% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Ccl11
Official Symbol Ccl11
Synonyms CCL11; chemokine (C-C motif) ligand 11; eotaxin; C-C motif chemokine 11; small inducible cytokine A11; small-inducible cytokine A11; eosinophil chemotactic protein; small chemokine (C-C motif) ligand 11; Scya11;
Gene ID 20292
mRNA Refseq NM_011330
Protein Refseq NP_035460
UniProt ID P48298

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ccl11 Products

Required fields are marked with *

My Review for All Ccl11 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon