Species : |
Mouse |
Source : |
E.coli |
Tag : |
Non |
Protein Length : |
74 |
Description : |
Murine CCL11 is belonging to the CC chemokine family. CCL11 was first purified from bronchoalveolar lavage fluid of guinea pigs. It was a strong and specific eosinophil chemoattractant in vitro. It can directly chemotactic for eosinophils, but not for monocytes or neutrophils. Murine CCL11 is approximately 63 % identical at the amino acid level to human CCL11. In addition, CCL11 also shows about 60 % amino acid sequence identity to human MCPs. CCR3 has been identified to be a specific CCL11 receptor. |
Form : |
Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : |
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using purified eosinophils is in a concentration range of 100-1000 ng/ml. |
Molecular Mass : |
Approximately 8.4 kDa, a single non-glycosylated polypeptide chain containing 74 amino acids. |
AA Sequence : |
HPGSIPTSCCFIMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTPKP |
Endotoxin : |
Less than 1 EU/μg of rMuEotaxin/CCL11 as determined by LAL method. |
Purity : |
>96% by SDS-PAGE and HPLC analysis. |
Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |