Active Recombinant Mouse Ccl22 Protein

Cat.No. : Ccl22-131M
Product Overview : Purified recombinant protein of Mouse chemokine (C-C motif) ligand 22 (Ccl22) without tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Chemotactic for activated T-lymphocytes. May play an important role in the collaboration of dendritic cells and B-lymphocytes with T-cells in immune responses.
Bio-activity : Determined by its ability to chemoattract human activated lymphocytes using a concentration of 10.0-100.0 ng/ml.
Molecular Mass : 7.8 kDa
AA Sequence : GPYGANVEDSICCQDYIRHPLPSRLVKEFFWTSKSCRKPGVVLITVKNRDICADPRQVWVKKLLHKLS
Endotoxin : Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity : >95%, as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Reconstitution : Resuspend the protein in the desired concentration in proper buffer.
Gene Name Ccl22 chemokine (C-C motif) ligand 22 [ Mus musculus (house mouse) ]
Official Symbol Ccl22
Synonyms Ccl22; chemokine (C-C motif) ligand 22; MDC; DCBCK; ABCD-1; Scya22; C-C motif chemokine 22; CC chemokine ABCD-1; SMALL INDUCIBLE CYTOKINE A22 PRECURSOR (CC CHEMOKINE ABCD-1) (ACTIVATED B AND DENDRITIC CELL-DERIVED); activated B and dendritic cell-derived; dendritic cell and B cell derived chemokine; small inducible cytokine subfamily A, member 22; small inducible cytokine subfamily A22; small-inducible cytokine A22
Gene ID 20299
mRNA Refseq NM_009137
Protein Refseq NP_033163
UniProt ID O88430

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ccl22 Products

Required fields are marked with *

My Review for All Ccl22 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon