Recombinant Human CCL22 protein
Cat.No. : | CCL22-67H |
Product Overview : | Recombinant Human CCL22 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 69 |
Description : | CCL22 is a protein that in humans is encoded by the CCL22 gene, which locates on the Chr. 16. The protein is highly expressed in macrophage, monocyte-derived dendritic cell and thymus, additionally, also detected in the tissues of thymus, lymph node and appendix. CCL22 can bind to CCR4, and is a chemoattractant for monocytes, monocyte-derived dendritic cells, and natural killer cells, but not for neutrophils, eosinophils, and resting T-lymphocytes. After secreted from monocyte-derived dendritic cells, the protein can be proteolytic cleaved into three forms: MDC (3-69), MDC (5-69), MDC (7-69). |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 500 mM NaCl. |
Bio-activity : | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 10-100 ng/ml. |
Molecular Mass : | Approximately 8.1 kDa, a single, non-glycosylated polypeptide chain containing 69 amino acids. |
AA Sequence : | GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ |
Endotoxin : | Less than 1 EU/μg of rHuMDC/CCL22 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | CCL22 |
Official Symbol | CCL22 |
Synonyms | CCL22; chemokine (C-C motif) ligand 22; SCYA22, small inducible cytokine subfamily A (Cys Cys), member 22; C-C motif chemokine 22; A 152E5.1; ABCD 1; DC/B CK; MDC; MGC34554; STCP 1; MDC(1-69); CC chemokine STCP-1; macrophage-derived chemokine; small inducible cytokine A22; small-inducible cytokine A22; stimulated T cell chemotactic protein 1; stimulated T-cell chemotactic protein 1; small inducible cytokine subfamily A (Cys-Cys), member 22; ABCD-1; SCYA22; STCP-1; DC/B-CK; A-152E5.1; |
Gene ID | 6367 |
mRNA Refseq | NM_002990 |
Protein Refseq | NP_002981 |
MIM | 602957 |
UniProt ID | O00626 |
◆ Recombinant Proteins | ||
CCL22-1874H | Recombinant Human Chemokine (C-C motif) Ligand 22 | +Inquiry |
CCL22-67H | Recombinant Human CCL22 protein | +Inquiry |
CCL22-082C | Active Recombinant Human CCL22 Protein (68 aa) | +Inquiry |
CCL22-18H | Active Recombinant Human CCL22, HIgG1 Fc-tagged | +Inquiry |
Ccl22-042C | Active Recombinant Mouse Ccl22 Protein (68 aa) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL22-7728HCL | Recombinant Human CCL22 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL22 Products
Required fields are marked with *
My Review for All CCL22 Products
Required fields are marked with *
0
Inquiry Basket